SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CGD0030058 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CGD0030058
Domain Number 1 Region: 904-1251,1354-1396
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.02e-70
Family FAD-linked reductases, N-terminal domain 0.0000446
Further Details:      
 
Domain Number 2 Region: 1233-1344
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-28
Family L-aminoacid/polyamine oxidase 0.00043
Further Details:      
 
Domain Number 3 Region: 647-741
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000896
Family SWIRM domain 0.031
Further Details:      
 
Domain Number 4 Region: 1492-1577
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000126
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CGD0030058
Sequence length 1937
Comment aalen=1937,86% Dbxref=vitis:XP_002280631.1,prunus:ppa000083m
Sequence
MESDDGSNSKAGPELQFDMGNKVELGLEKDSLQHSLKPRNKKMDSGGGPKKRVKVTPVEV
GFDSGDDEPIGSLLKLRKPKNPKKIKAGLEGSVEKCHKVEVKAHKILGEAEEDLGEMNDT
LASFRKKLKCPKKDIEPGTMRGRGYALNESVEDDGVLDGNSESKTVEKGQDIGEDRSNVV
TDKGIERKSTGKVRRGKFDSKAKATGDDDDSEGLESQVEEDHNEGGLWPGEASDQPLDEK
LEESLSTFFQRVQSGSQRKSLPNSCLKQNCKATHHAFVSKNPSRKCDDSSLSVSGTSLWH
STSKECNTAVNQRFDDGVCQQETILEPCDLNAQKGPIEDPCRSPKVCEKDGNRHSNIQLR
DNCSAVDQSGKPESEGLKDGLELQSTAKTGSLVPCVVEMANSLSSSNLMEEIHGSSAGGL
VPQSMDISNKYILSADPEIYSIGEENSNDELLNKSYENACEETAKLESGYVFNQYQEGSQ
QIQLNLSLSAVDSLKMEETCSDGPNTCAEEKSLETHVHPNELVASIRRCNSALHQPSEDA
SHGACVPSHDCFSVNEEADGDSPTSLTPDENESCHEDVVSLPSSEIKDSKSSAIQRAGRN
IKKRRHGDMAYEGDADWENLISEQGFFGSQQFVDSDRSFRAREKFDEAAVSAGLKARAVG
PVEKIKFKEVLKRRGGLQEYLECRNHILGLWSKDVTRILPLVDCGVTDTPSEAEPARASL
IREIYAFLDQSGYINFGIASKKEKAEHNAKHNYKLLEEENFEGSSGASIADSEDGVAFIL
GQVKTTEAPAEAKSGVRVDDQNLASEAKLCEVSVDSITPELPNVKIQEECLSDNCQQNDS
IDVKLNPGLINLQVPSADLSCDVVDMGIAPVVTPEERNDSQYVQSAAYDNPYWNDHLKGD
SEVRKKIIVVGAGPAGLTAARHLQRHGFSVVVLEARNRIGGRVHTDCSSLSVPVDLGASI
ITGVEADVSTNRRPDPSSLVCAQLGLELTVLNSSCPLYDIVTGQKVPADLDDALEAEYNT
LLDDMVFLVAQKGEKAMRMSLEDGLEYALKRHRMAEIGADIEETESHSSVEAFYDSKASN
VIGNFPEEKCSKEEILSSLERRVMNWHYAHLEYGCAASLKEVSLPHWNQDDVYGGFGGPH
CMIKGGYSTVVESLAEGLLLHLNHVVTNISYSPKDSGTDDSQHRQVKVSTLNGSEFSGDA
VLITVPLGCLKAGAIKFSPSLPQWKHSSIQRLGFGVLNKVVLEFPEVFWDDTVDYFGVTA
EETDRRGHCFMFWNVRKTVGAPVLIALVAGKAAIDGQSMSSSDHVNHAVIALRKLFGEAS
VPDPVASVVTDWGRDPFSYGAYSYVAIGASGEDYDMLGRPVENCLFFAGEATCKEHPDTV
GGAMLSGLREAVRLIDIFTTGNDHTAEVEAMEAAQRQSESEKDEVRDIIKRLEAVELSNV
LYKNSLDRARLLTREALLRDMFFNVKTTVGRLHLAKKLLGLPVESLKSFAGTKEGLTTLN
SWMLDSMGKDGTQLLRHCVRLLVLVSTDLVAVRSSGIGKTVKEKVCVHTSRDIRAIASQL
VNVWLEVFRKAKASSKRKNLKDAASGKPPLRSHHGAFENKRSLQDPLSAGSQYPINVKEN
GKSMGVEAVNLAMSEEEQAAFAAEAAARAAAKAAAEALASTEANCNKLLQLPKIPSFHKF
ARREQYAQMDERKWPGGVLGRQDCISEIDSRNCRVRDWSVDFSAACVNLDSSRMSVDNLS
QRSHSNEIASHLKLREHSGESLAVDSSIFTKAWVDSAGSGGIKDYHAIDRWQSQAAAADL
DFFHPTMHVKDEEDSYTSSRQPTWKHDGRANESSISQITVNKERFKNHPRGADRIKQAVV
DYVASLLMPLYKARKIDKEGYKSIMKKTATKVMEIASDAEKNMAISEFLDFKRKNKIRSF
VDKLIERHMAMKPVMNT
Download sequence
Identical sequences A0A061FDX8
CGD0030058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]