SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000013906 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000013906
Domain Number 1 Region: 20-211
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.11e-31
Family RNA methyltransferase FtsJ 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000013906
Sequence length 259
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_24:7339:8227:1 gene:maker-piw_contig_24-fgenesh-gene-0.2 transcript:EPrPWT00000013906 description:"Ribosomal RNA methyltransferase."
Sequence
MTKSTDANRDIYYRRAKEVGFRARSAFKLLQLDEQFKILKDVQRAVDLCAAPGSWSQVLS
RKLYDPSVTTSIAEAESDDVRIVSVDLQEMAPIPGVELIQGDITSKKTAEQIISYFKGKK
AQVVVSDGAPDVTGVHDIDEFVQAELLAAALNITTHVLEEGGSFVAKIFRCQQYDLLATQ
LKVFFTNVSCSKPKSSRTQSNEAFVVCQGFKMPEGYSPVMTSYLLSRYGLEEGEPHDPVL
VPFLTCGDLSGYDALQEFE
Download sequence
Identical sequences EPrPW00000013906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]