SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000019987 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000019987
Domain Number 1 Region: 7-560
Classification Level Classification E-value
Superfamily SIS domain 2.43e-178
Family Phosphoglucose isomerase, PGI 0.000000000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000019987
Sequence length 562
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_966:4011:5699:1 gene:maker-piw_contig_966-snap-gene-0.6 transcript:EPrPWT00000019987 description:"Glucose-6-phosphate isomerase."
Sequence
MAAQLISDTAAWKRLQEHAALIKSSTHLRELLADEKRNAALRTEQEGVFLDFSRQNATTQ
TLDLLFDLAEAAGLSKKLAAIASGEHVNSTEDRAVLHMALRAPADQKLVVDGQDVIKDVH
EVLDAIKAFTDSVRSGAKLGSTGKAIKNVISIGIGGSYLGPEFVFEALRYEPEAKAASTG
RTLRFLANVDPVDVARATSGLNPEETLVIVVSKTFTTAETMLNARTLRKWLVDDLTAKGV
SSADAISKHMIAASSAVPLVEEFGIDRNNIFGFWDWVGGRYSVTSAVGILPLALQFGFGI
SKQFLAGAHNMDNHLLTAPPRSNLPVLMGLLGVWNSSFLGHSSRALLPYSQALLRFSAHI
QQVDMESNGKRVTVEGVDLPFEAGEVNFGEPGTNGQHSFYQLIHQGRVVPCDFIGFCESQ
NPVLLAGEPVSNHDELMSNYFAQPDALARGKSLQDLEAEGVPEHLRNHKMFPGNRPSVSL
LFPKLNAFTCGQLLALYEHRTVVQGAIWGVNSFDQWGVELGKVLAKQVRTQLTASRTTNA
PVQGFNSSTAFMLNKYLAHKSA
Download sequence
Identical sequences EPrPW00000019987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]