SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000021035 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000021035
Domain Number 1 Region: 2-326
Classification Level Classification E-value
Superfamily SIS domain 1.24e-65
Family double-SIS domain 0.00000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000021035
Sequence length 327
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_1256:5:1072:1 gene:maker-piw_contig_1256-fgenesh-gene-0.0 transcript:EPrPWT00000021035 description:"Glucosamine-fructose-6-phosphate aminotransferase"
Sequence
MLKIKHLMIAACGTSLYASKYGAKLMRSLNSFDTVSTEDASECASDRLPKKEGGLLVVSQ
SGETKDVHRVLKCAEEMPAEIPTFSVVNTVGSLIARSTKCGVYLNAGRENAVASTKAFVT
QVTVMGLIASWFAQNRADGNRTKMDELIQCMHRLPIAIGMALRSRELCAGIAEKLMGSEH
LFVLGRGYGEPIAYEGALKIKEITYLHAEGYPGGALKHGPFALIENGKDGKFGATPIILI
VLDDEHATHMKTCAEEVRARGAYTIVITDNPKMCENIADTIIPIPTNGPMTALLASIPLQ
LIAYELAVRKGINPDVPRNLAKAVTVD
Download sequence
Identical sequences EPrPW00000021035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]