SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000027020 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000027020
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.28e-24
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000027020
Sequence length 176
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_5811:146:892:1 gene:maker-piw_contig_5811-snap-gene-0.1 transcript:EPrPWT00000027020 description:"Ankyrin repeat protein."
Sequence
MEAWFESAIADDEQCVEELLAADPGLLNRVHLQYERTALQLAAAWYAPRVVAVLLTHGAD
IHASDPEGLTALHLAATSNCVSSLELLLRHHQQCQEQQRSSTDTPKATRGNAVNQRTRGG
FTPLLLAAARGHHECCSLLLKLGGADPLVALDTPPFSTALDLALLGQHQKDEGVAL
Download sequence
Identical sequences EPrPW00000027020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]