SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000014886 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000014886
Domain Number 1 Region: 144-474
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.56e-26
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 82-159
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000115
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Weak hits

Sequence:  EPrPW00000014886
Domain Number - Region: 479-543
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000706
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000014886
Sequence length 570
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_110:27009:28721:-1 gene:maker-piw_contig_110-snap-gene-0.7 transcript:EPrPWT00000014886 description:"Ankyrin."
Sequence
MASPAPLPLFTSAAVVCRRHGLEALPHVVERITALLDCVTLERWTIERACKLNDLRLLGR
LAAAQELLGIDPHYKKFLASQGLVAAVRNDNLQIVSWLCLEYCPSLIPMKGIEEAARLDN
IDILEWVFACHKSALWTKRVAEAAVENGHLEILKVALSHIEVVELVAELLCCAAERGHLK
TASWLHDHRTQNQPIAVISDFTGVWDQRVLLNTILAGHFEVAQFLHSRGYPLVIDRYRQL
SSSAVWGNLEMTKWLLELPQAKGSSGWIDEAAGAGHLHIVQWIYKHLPNDRCTENAMDYA
AKDGHLNVATWLHEIRTEGCTTRAMDGAAENGHLQVVQWFHEKQTEGCTTSAMDRAAANG
HLDVVQWLHTHRAEGCTSQAMDEAARNGHLDIVKWLHNNRTEGCRTRAMDVAASEGHLEV
VQWLHENRSEGCTTDAMDYAAKNGHLNVVKWLHENRTEGCTIEAMDNAGSLPVTQWLQEN
RTEGCTIYAMENATRFGCLDTLLYLHANRNEGPTHRTALCAVANSNLEVFEWVWANYWNR
VDLDRIAARCGWKPNLYASALVEQMRSIHQ
Download sequence
Identical sequences EPrPW00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]