SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000015485 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000015485
Domain Number 1 Region: 242-309
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000233
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 137-159
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000034
Family CCCH zinc finger 0.0036
Further Details:      
 
Weak hits

Sequence:  EPrPW00000015485
Domain Number - Region: 183-203
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00113
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 334-361
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00366
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000015485
Sequence length 430
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_177:14994:16819:1 gene:maker-piw_contig_177-snap-gene-0.12 transcript:EPrPWT00000015485 description:"Makorin."
Sequence
MHRAATAPSSSRQSQYYSSDEPDEDSAMSYYQQNMGWAMPSPATVTSNQRGWTGADSDSG
DEDMYEHEYDVADDYDSDGYRYEDYLYMDHYGDGEDDEEATLPVPARGAQSSNQHSNNTN
ASRRAAAAQPKPAPPAPVLCRFYVLGKCRYGSHCTYSHEIPAPSEDCEMTEQDSLTAAAA
LVDCPYFLRGNCKYGQYCRLRHTGASAANGAVQQAQSSAAAATTNTGAAGSATANQSNYQ
ASVDGTQPEQEFTCGICFDDVVDSGKHFGLLSCDHCYCLDCLRSWRQSKDMEAEVTRSCP
VCRLPSNYIVPSLTFCTGERKQQVVDAYKSHLSVRECKYFNGLFGSCPFGQHCFYAHRNS
EGHDIKHLDRPRRNSKHGRGGGGGGGRGRGLASNESLSSLLSNYGSLFRFLESLDWDEYG
DAFEMDSEWD
Download sequence
Identical sequences EPrPW00000015485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]