SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000022704 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000022704
Domain Number 1 Region: 221-466
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.47e-21
Family Ankyrin repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000379
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000022704
Sequence length 578
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_1817:4607:6355:1 gene:maker-piw_contig_1817-snap-gene-0.1 transcript:EPrPWT00000022704 description:"Ankyrin."
Sequence
MTKMLEGSVDAQMLVATDVTSAPPLACVTAALTSLSDNQTNARQLVGSLLHAITAISVFL
DYGRAPFWTILRACERGLLSLLPRLANQSHADMDVHFREHLFTKGLLHAVRNENLEMAQW
LCCVYCPYGFVWQVVEEAAGMGNVCILHWLMNRYRYTRIHPTLIDFAVKNGHFEAAKWIH
TNIRRVTCSPATMAAVIKTGALQLVEWFVARYPEDPDQVFLYSAITTGNVELAGYLFYRG
YQVYSRDVYGAAAQSGNLEMLSHLLTLATSTDALQTASLGGHFDIVQWIHMNIPDIVNTT
NILDFAATGGHLELLQWLHDKYPHAISTCAMDLAAKNGHLEVVKWLQTHRPEVCTTHTMD
GAAENGRLDVLEWLHANRSEGCAEDAVYMAARFSHLNVLQWLHEHGYPGFKADTMYWATN
HNRMDMVQWLLENRTEGCNTSAMDGAAENDHLDMVKWLHENRTEGCTTDAMDAAISLEMV
QWLHENRTEGCTERAMATAVKKGPFEVGFFLSARRDEGNMDIAVFNAAAGRHFALFQWLH
ARYPNQILNKSINYTLDAKSSLMEIGFWFVDIIVSYLL
Download sequence
Identical sequences EPrPW00000022704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]