SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000024159 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000024159
Domain Number 1 Region: 219-338
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000315
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 2 Region: 626-741
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000167
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 
Domain Number 3 Region: 1-41,70-134
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000327
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 568-626
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000915
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Weak hits

Sequence:  EPrPW00000024159
Domain Number - Region: 177-217
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0114
Family PDZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000024159
Sequence length 841
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_2547:1052:3853:-1 gene:maker-piw_contig_2547-snap-gene-0.1 transcript:EPrPWT00000024159 description:"Conserved gene of unknown function."
Sequence
MEGVLWVRVRRGKLLHGWQKRYFVLSDDGVLKEFAESVSVNAAPSSSSSPKRRHLAANQS
ALAERSGMMLKDEMLVLGAVVKTLPFPLVGRNNAFQVAKKGEFRLALAAKSADDLHQWVD
AIRAIASIGTARTEDEFLDVPMLQQTDAKKFADGYEWFNERVRTTRDLILECVAVPRGSV
LVAVNGISLQTLTTDQVKLMLGKPSTVMTLGLRFLRTPYKKGVLKCKMCLSLTTQLKTIA
QYRNGLREWKQQVVEVDGDVLTCYPRSEAKTNKTRRLIPLTGGCTVKTVHEIVTEQKFCF
MVTARAYSMLFQARSDDEVRRWTEVIQRAIHLAEGVIPGQERPSLDSMQLQSSLNMRSLQ
NSLAFADSSSDDLQRTNCGLTADGDETQGDLEADSEDGDRTALDPQGLYPSTEDWDSATQ
STAYLPAQDLSEMLFFLQRSGRLVEAFQLMGRNTSHRSEYWKKIFLWALDPIDEDAFVKL
QALPLAEADSIQVQKDIPRTSKWLAGSAGAPQLSLEARQVRLDHLEHVLHAFLSGCTSHV
RTDEEEEGKESEDETGGTVPRVGSKNFYMQGMNGLAFILLEVLDEDELTAFQFFRGVIVR
ILPHVFGIRSQGAERDNFDLFSSLVEVGNILQEVVALHLPNFSAAMDDAGIPVCLLAYKW
FPTLFSDISLMAHNAQLRFDTLLVIWDICLLMGLEGIFCVSLALFSSAEDNVVSVRDASA
EHISNALVHVLSQIKPEDLITSVCEVLELCSHPVLLKLRNGHRRRLQLGYSKQKYDGARQ
KHPAVQTSSALAGGSSSANSTSGGATKTTNFSPMTVRDLDSGKLFKISRTGSMLLPVMKA
V
Download sequence
Identical sequences EPrPW00000024159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]