SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPW00000024883 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000024883
Domain Number 1 Region: 278-481,513-586
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-20
Family Ankyrin repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 165-226,260-309
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000392
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000024883
Sequence length 650
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_3060:187:2139:-1 gene:maker-piw_contig_3060-fgenesh-gene-0.0 transcript:EPrPWT00000024883 description:"Ankyrin."
Sequence
MTDISTAAAANYHESVIASQSSAGGKSAYLPPPTSDEELSPLHVLTRVHVVCRTQPLLAG
LQHVVLAIDALLYHPQHFHKTLTDAVADDNLHLLRHLLSDVTTRARTGDDGRDDSIVAQH
SLFVGLQVTKAACVALQSHSSSASSKRLLRCLHAFNREAVGANEVFGAAAATGDLELVKW
LHASCPLDPETVDSSQAAASAGGSGHTHVLEWLFTNRWSARSKFPLDQVVKNNQHRVLTW
LDEHNRNRVEASLDPVTVYIGPGVIRDAASQGDLDMLAWLFVHPRDESVAYAGDGAAANG
HVGVLDWLLENHPQDAQCYADGYTGAARNGHLEVLQWLYAHYPKRFWTESMEEAAHFGHL
AIVAFLREQGDDGDAIGETGVLASRGGHLEVLKLIYDWYPAACRQAMQLAGVSGNLELVK
WLHEVKGHIPTYMNTINHTILNGHIHVLEYIFEHMGERYQGISNLISNAASGNRMDVMEW
IHVKVLEFDARLVDPPQGLDRWMVFRDGTHSLPMMYAARNGNLEMLRWLVANGYDDCTSR
AMTFAASQGHLDVVKWLHEHRTEGCTTDAVDLAVRNRHPRVVEFLLLNRQEGCTSAAARD
AIELHHDVELIHLLFVYRPDLIDFESVRAHANGHEAMLRWLRLVDGANSL
Download sequence
Identical sequences EPrPW00000024883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]