SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70606979|ref|YP_255849.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606979|ref|YP_255849.1|
Domain Number 1 Region: 64-203
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.4e-23
Family FHA domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|70606979|ref|YP_255849.1|
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00369
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606979|ref|YP_255849.1|
Sequence length 206
Comment hypothetical protein Saci_1210 [Sulfolobus acidocaldarius DSM 639]
Sequence
MTWKCNLCGYENDDDALFCIKCGAQKSSEAQQLPQQQPSEPQAQGVVTQQQVVTNPPVQA
QVATPQQPAQQPVLPQPEPAQPQPVSSTPAPQQASQPTNRYYIYFIQTPNENLVNKKVLL
NFDLFPSVSMGRSPENIVIVPDSEVSRKHAVIYLDNSELYIEDLNSTNGTYVYDGKQFTP
IKGKQKIEPNSIIKLGNQTIVRILKE
Download sequence
Identical sequences A0A0U3H8R9 M1J5J4 M1JCF3 Q4J9H4
gi|449069482|ref|YP_007436563.1| gi|70606979|ref|YP_255849.1| 330779.Saci_1210 gi|449067211|ref|YP_007434293.1| WP_011278058.1.100797 WP_011278058.1.13097 WP_011278058.1.15291 WP_011278058.1.18585 WP_011278058.1.18739 WP_011278058.1.19907 WP_011278058.1.20267 WP_011278058.1.24072 WP_011278058.1.28054 WP_011278058.1.29213 WP_011278058.1.30898 WP_011278058.1.31299 WP_011278058.1.3283 WP_011278058.1.33024 WP_011278058.1.33782 WP_011278058.1.34459 WP_011278058.1.34536 WP_011278058.1.35781 WP_011278058.1.35800 WP_011278058.1.36276 WP_011278058.1.37881 WP_011278058.1.38112 WP_011278058.1.38253 WP_011278058.1.39308 WP_011278058.1.39398 WP_011278058.1.43265 WP_011278058.1.4394 WP_011278058.1.45682 WP_011278058.1.48356 WP_011278058.1.49892 WP_011278058.1.50721 WP_011278058.1.51246 WP_011278058.1.5150 WP_011278058.1.53520 WP_011278058.1.55288 WP_011278058.1.55517 WP_011278058.1.56706 WP_011278058.1.57256 WP_011278058.1.64117 WP_011278058.1.64360 WP_011278058.1.67449 WP_011278058.1.68798 WP_011278058.1.7301 WP_011278058.1.74875 WP_011278058.1.78046 WP_011278058.1.78998 WP_011278058.1.8042 WP_011278058.1.83345 WP_011278058.1.87279 WP_011278058.1.90653 WP_011278058.1.90680 WP_011278058.1.95134 WP_011278058.1.96274 WP_011278058.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]