SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC09909-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC09909-PA
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000439
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC09909-PA
Sequence length 83
Comment ACEP_00009909-RA protein AED:0.389880952380952 QI:0|0|0|0.5|0|0.5|2|0|83
Sequence
MTQNTEASSRMKPLSVIIRRPGRKGIGNESLLAGKRYDMECETTGSRPPAVITWYKGRRR
QLKHTTVRKKNKKYNGKLRGSST
Download sequence
Identical sequences AC09909-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]