SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC15915-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC15915-PA
Domain Number 1 Region: 31-70
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000904
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC15915-PA
Sequence length 79
Comment ACEP_00015915-RA protein AED:0.19375 QI:0|0|0|0.33|1|1|3|0|79
Sequence
MPCHFDLELSTYKMPKVEIVDEHGATAGDKFYKAGSTIELKCVVSNIPQPTGYVTWRHGS
RTLNYDTTRGGISTVLKYS
Download sequence
Identical sequences AC15915-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]