SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC01838-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC01838-PA
Domain Number 1 Region: 27-264
Classification Level Classification E-value
Superfamily L domain-like 2.49e-45
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 262-358
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-19
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC01838-PA
Sequence length 638
Comment ACEP_00001838-RA protein AED:0.00925704888464496 QI:0|-1|0|1|-1|1|1|0|638
Sequence
MGVSVFLLYAVTVLGVAASDNCADKCSCKWKSGKRTVECVNRDLTSIPEWIDPETQVLDM
SGNNICHLPNNIFIHVRLTNLQRLYLRECRIDRIDSEALAGLTNLVELDLSNNMLAAVPS
LSFTDTPFLRDLVLAYNPLKRIRSHAFKSTPNLVKLDLSHTQLVEIEAKGFRGLEMLESL
KLSNNELSTLHPGTFEPLNKLTSIELHENPWICDCHLREMKMWLVKHNLPTIVAPVCHGP
QQLLDRAFTDLGIDDFACRPILLIASRYAEATIGENASIVCRVSAIPPADVKWYWNGRLL
TNHSAFSSYQKILIFEEGQFRKRSTLILTNAQEADSSEFYCVAENPAGSVEANFTLHVSL
RTAGMSTLGSGQIAGISAALVVLILFILLIILVLFIRLRRMPLKDMKSSAPMEAASSDGN
GGNGGGGGGGGGDNNPSSATSTTRRKHEEIETTSFALESKPPASLHLSYVQRPHAAVMQE
SEYSTISRFDDQNQPAVAAMPGAGCFSSTTSLMPIDNPDLIRDTRRGSTEDITPYGVADY
GRVEALDDAGKMLYTSCLWEARDSCGRTSAVSANMYPSKEQLAVVAPVVEQFPPGAKQMR
VWQKGVPVLPPVSALKRVLGSTRSSPDEGYQEGTGTDV
Download sequence
Identical sequences A0A158NXN6
XP_012062294.1.45171 AC01838-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]