SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC02105-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC02105-PA
Domain Number 1 Region: 327-753
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.85e-113
Family PIWI domain 0.0008
Further Details:      
 
Domain Number 2 Region: 33-348
Classification Level Classification E-value
Superfamily PAZ domain 1.18e-69
Family PAZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC02105-PA
Sequence length 753
Comment ACEP_00002105-RA protein AED:0.358753315649867 QI:0|0|0|0.12|1|1|8|0|753
Sequence
MKNEFFYVAGGSGDAGAVAIVASGRGTSGIHKVIKVNYFKVLKATDWALYQYHVDFSPEE
DRTIVRKTLLKVHQKKIGAYIFDGTVMYTSCRLSDRMVFTSTRQSDEQHITITVRLVGDM
LVGDPHYIQFFNILVRKCYEVLKLKLVGRHYFDPRSKIVLPEHKLELWPGYVSSIRQHER
DILMCVEISNKVMRLETLGDILNNFYREDRNRFRENFCNAVIGTVVLTDYNNNTYRIEDV
DFSASPSSSFPLKNGENITYIDYYRKKYDIRIRNPGHPMLVTKSKTKDRQAGEGERVYLV
PELCRATGLTDSMRENYRLMSSLAVETRLQPGKRIEKLLKFNKRLCEDRTIVQELSEWNL
QLDNKLLQIPARQLLNEKIYFGGDVSANAEQGDWTKAMMNKKCSFIPTLLKVAAGMQFQI
DKPRSEYIRDDRPGTYNERLEQILSRQIPQLIFCAVSNNRSDRYSAIKKKCCVDRPVPSQ
ICLTRTMTHRNIKSIATKIAIQMSCKLGGAPWYVDIPLEGIMMIGFDVCHDTTMKNKDFG
ATVAILNRRMTQYFSAVNVHHTGEELSNDLSDNICKSAQAYYALNKTLPGRIVIYRDGVG
EGQVPLVMDREVIQIKKKLDGLYGGPDRYKMAFIIVTKRLNTRFFENNNNPEPGTIVDDV
ITSPIKYDFFIVSQKVRQGTVTPTAYSVVYDTLGMDPDKIQRLTYKLTHMYYNCSSTVRV
PAPCHYAHKLAFLVSKFIHRAPDTQLQNTLYFL
Download sequence
Identical sequences AC02105-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]