SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC02743-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC02743-PA
Domain Number 1 Region: 45-282
Classification Level Classification E-value
Superfamily L domain-like 1.45e-38
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000028
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC02743-PA
Sequence length 680
Comment ACEP_00002743-RA protein AED:0.000734214390602062 QI:0|-1|0|1|-1|1|1|0|680
Sequence
MLVTRPHPLGGRILLALFLLTGCFALLSRAAAFPDWTDCPAVCRCKWTSGKKSALCPDAG
LTSLPASLDPDMQVLDLSGNKIPALKEEIFKLAGLVNLQRVFLRNAGIYSIHANSFKDMR
ILIEIDLSDNHVMTLEPDTFLGNERLRILILSGNPLGTLRNLQFPVLQHLRNLELQRCSL
TEVHGQAFARLTGLEFLKLDTNQLEYLESSVISGLARLKTLTLDGNRWRCDCRLRDFRTW
LIPDVPSKLYSVPQICSGPPRLEGRRWEDVKPTEFACEPKVFVLASSIQEETNGNLSLAC
RTSGDPEPEVWWQLNGGPVNATKSTDQPYMGTLVIYATSEAGIPSNDKSASRTVGDRWSN
LTVYNASDSDAGEYACFAKNIAGLARDTVSVAIPRVYTAPTLSQSDNWLLWVSLAGGGAA
AACASISAVLLVLCLCGGNRRHSKREKVKLQSSSSFGDQEKKLLDLSVTTTTTPGNSNDR
GSGHGSIGEACSTGDLELAERSSICDSMAAAAVTVERLRPADNSVNTIRAVPCAATATAG
VFPPPPPEFTTGVLPAGIFGNIFISVSLPQDASSERCYPDLLDIPVHAVSSATTTVSTGG
KTAALSSATAINVSSFATLPRRALRSTEIAAGSPYDNMGPRITANGSSAFSLTDMTDMDL
RLSPPPPPRIIQPPHEFVSL
Download sequence
Identical sequences A0A158P037
XP_012063145.1.45171 AC02743-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]