SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC04211-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC04211-PA
Domain Number 1 Region: 455-883
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.33e-118
Family PIWI domain 0.0027
Further Details:      
 
Domain Number 2 Region: 148-474
Classification Level Classification E-value
Superfamily PAZ domain 4.87e-60
Family PAZ domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC04211-PA
Sequence length 911
Comment ACEP_00004211-RA protein AED:0.144072788809631 QI:0|0.42|0.33|0.6|0.64|0.6|15|0|911
Sequence
MMKQRAQMQRSQTHHSLETPSVSSVEQTSRSSEGYSSHASSSSGGRGRARIPGWLRSLNS
SSSEESKNSSLAIGHGRGAIPSLIRKLSKPSTSFIPESVSKDDFEGVLGKLADISVYNNP
PSSEDLQSPNDIAPICRQGKAGMKIEAYCNYVDLILEPGKGLFQYEIKFSPNIDSVGLRR
KLLNQHSAALGRTRIFDGTLLYLPIKLFQDVSLRTLIENFYINTMYISHYKSEHPMDGSK
VTLTIIFKKKESMCNIQFFNVLINRVMRALSLVRIGRQNFNPKGAYALPQHRLEVWPGYV
TAVNEYEGGLKLCLDAKHRVMRTETVRDLIREIFQKSHYNYQDAVINEIVGTSVLTRYNN
KTYRIDDVAFNKTPTDMFFKNGEQISYIDYYKINWNIQIEDVQQPLLVHRDTARLPSGEK
EERTIYLIPELSYAAGLTDNIRNNHYIMKDLSGVTKMSPNQRRDVIRRFLEEVQRTDVTR
EILSEWGLHLSSDLVRFTARHLEPEMIHFGNNKIFKTTERADWSNCVRDFLEQLKKVAIA
INMQIDSPKQVTLRDDRTETYLREIQNNLTDNLELLVIVFPTNRTDRYSAIKKLCCVQKA
IPSQVIISKTISKSHKLKSITEKIALQINCKLGGALWTLALPLKNCMICGIDVYHAGVGG
GSRKSVAGFIASLDTRLTKWHSRIYMQASKQELVDMLQVCLTSAINAFHKYNGCNPERIM
IYRDGVGDGDLDYVENYEVKQLLATFNRIAPNYKPQLSVIIVQKRINTRIFIKGRDGLDN
PAPGTIVDSCITRRNYYDFFLVPQNVRQGTVTPTHYIVIHDSSNMETDLMQRLTYKLCHL
YYNWPGTIRVPAPCQYAHKLVYLVGQNLLAEPHRSLSDILFYLQENTWKVLCLSYVYLAM
KHDVTIMRFSI
Download sequence
Identical sequences AC04211-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]