SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC05249-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC05249-PA
Domain Number 1 Region: 994-1058
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 6.02e-16
Family Tachycitin 0.0064
Further Details:      
 
Domain Number 2 Region: 1065-1119
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000034
Family Tachycitin 0.0088
Further Details:      
 
Domain Number 3 Region: 271-336
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000654
Family Tachycitin 0.01
Further Details:      
 
Domain Number 4 Region: 790-839
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000139
Family Tachycitin 0.01
Further Details:      
 
Domain Number 5 Region: 705-763
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000141
Family Tachycitin 0.011
Further Details:      
 
Domain Number 6 Region: 638-685
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000157
Family Tachycitin 0.0073
Further Details:      
 
Domain Number 7 Region: 572-621
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000173
Family Tachycitin 0.01
Further Details:      
 
Domain Number 8 Region: 925-983
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000262
Family Tachycitin 0.0077
Further Details:      
 
Domain Number 9 Region: 360-429
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000251
Family Tachycitin 0.028
Further Details:      
 
Domain Number 10 Region: 858-910
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000785
Family Tachycitin 0.0053
Further Details:      
 
Domain Number 11 Region: 27-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000173
Family Tachycitin 0.003
Further Details:      
 
Domain Number 12 Region: 1457-1516
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000183
Family Tachycitin 0.019
Further Details:      
 
Domain Number 13 Region: 1679-1726
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000126
Family Tachycitin 0.016
Further Details:      
 
Domain Number 14 Region: 1143-1201
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000246
Family Tachycitin 0.017
Further Details:      
 
Domain Number 15 Region: 1360-1407
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000175
Family Tachycitin 0.012
Further Details:      
 
Domain Number 16 Region: 1257-1303
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000288
Family Tachycitin 0.026
Further Details:      
 
Domain Number 17 Region: 1562-1618
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000628
Family Tachycitin 0.022
Further Details:      
 
Weak hits

Sequence:  AC05249-PA
Domain Number - Region: 1778-1807
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00732
Family Tachycitin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC05249-PA
Sequence length 1808
Comment ACEP_00005249-RA protein AED:0.366150442477876 QI:0|0|0|0.25|1|1|4|0|1808
Sequence
MKGTYLIVLVITLGIALNGSLADIPTKCPEINLQNETFFIPHENDCTKFYSCHMGVKGKP
IDCPFMDENGNKLHFNPKLQVCDWPWSAGCQTPSSNSTTSSNIPTIITPNTTTSSTPTTP
TSTLITTTPSTSTSTTPIPTTPSSPTPTTPTPNTPTLTTPTPSSSIPTTPTTSTPSSSTP
TTPTLSSSTSTTPTPSSPTPTTLTPSSPMPTTPTTSTPSSPIPTTSTPSSPTSTTPTPSS
STPTTPTPSSATPTTPTSSSSTPTTPIPSFPTPPLDSCESDNRTHMLPHETKCDHYYLCF
NNWVSPISQKCDRNLLFNSLLRVCDYPENVNCKNSSPNTDKSSLSSISPPFNYSLPTNSD
PVAWVCEPNSKYKIPHEIICDYYYWCVNGTRGMNWVRCESNLLFNPVIGECDYSENVNCG
YRSTLSPTVPSSTIRITSSITTTLTIPTTTTSTTPTTTTSTITTLTTTTPTTPTTTTSTT
PTTTTSTTPTTTTSTTPTTTTSTTPTTTTSTTPTTTTSTTPTTTTSTIPTTTTSTTPTTT
TEITITTPTETTTKNPNEPRKKCPPKGSTEKARIAHPCLCNQYYDCIDGEKILQTCPIGK
HFDYMREICDWASVVKCIRPIPTFKILTSDIDDYNTTCAPEGRAFQHDTDCSAYYLCSNG
EKILRQCMEGLHFNMTIQTCDYPQKSCDLNRSSPRINLDICPPPNSVQEVFLPHECECTQ
YYECIDGKKFLRFCPNRLHFDPVWQICNDPIEAKCVVDIISTTSTSIFTTSSTTEAIDEP
RTTCPPKGSTEKVRFPHPCLCNQYYECVEGDKVLQTCPINMYFDDATDVCDWSTEVKCIS
QFSSHDIQINDYDNNNNKCSPNGRAFNHEDSCTEYYLCSEGEKVLQYCLEGLHFNVSIQM
CDYPQKKCNLNTPGPQPIPTVTLNICPPDSIQQVLLPHECDCTQYYECIDGKQILRDCSD
GLHYDYVHQICNVPIKAKCNDFTTMIPQSSFPTIPDSSKCYDENNEIPHENDCRLYYKCN
NGEKILKTCPRNLYFNPKLRVCDYPENVACNVEENIPSTSTPIKCETITETTNIPHETNC
NLYYVCDNGVSILKKCSPNLVFNPILKVCDFPENYVCKITRDKNNIKNIDKIVQNLDPFT
CIGTCPEEDPDYAVLLPNDDCKKFCMCSGGVAWIQLCPEPLYFDSVEKICKKKKDAVCGT
RLYNQDSSFKIDKIVDNDDSLQPLADENDNERETYDRSLDPSSCIGTCLEENPKHAVLLS
NDDCKKFCLCSNGTTYVQPCPELLYFDSIDKACKRKKDAVCAVRSLMFDRIFDDDSVSLS
EKDYNERDLYDNPWYKRLFYNVDPSTCIGICPEEDTDYEELLPHKDCRKFCICRKGLTYV
QLCPESLYFHSVEKVCKQRRHAVCATNSFKRYHAITNINREDDEDDDEDNSIEFLRENNK
RRRHNYLWPHFHNFNPTTCIGICSNSKYAVLYPHTDCKKFCLCSNGFMWIQSCPESLYFD
SIHKRCKQKKEAVCAVHKQVNENQRIEIQERNDEHEIYNSWSRLHSYQDISTCIGTCFNE
DYDYAVLLPNLDCKKFCICSRGLIWIQSCPKSFYFDFVDNICKLKKNAICAINRYTNRFF
TFNKVIDENNSMSSNEEKNHKIHDNTWSKLYFSNHESFNNFDSSTCIGTCPEEDPEYAVL
LPNDDCKKFCMCSGGVAWVQSCPDPLYFDSVQKICKKKKHAVCGVRLYNQDSIFIIDKTV
DNDDLMKTLTTENNERATYDNLDPSTCIGTCPEEDPDGGVAWVQPCPEPLYFDSVQKTCK
RKKDAVCG
Download sequence
Identical sequences AC05249-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]