SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC07436-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC07436-PA
Domain Number 1 Region: 347-795
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.84e-109
Family PIWI domain 0.0027
Further Details:      
 
Domain Number 2 Region: 113-366
Classification Level Classification E-value
Superfamily PAZ domain 1.06e-58
Family PAZ domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC07436-PA
Sequence length 795
Comment ACEP_00007436-RA protein AED:0.371859296482412 QI:0|0|0|0.11|1|1|9|0|795
Sequence
MSKQERNRGYDDPYEPSTSSGHRRSKPYEKKRSEPHYCVDDYAVPSTSKHEPMEDISGIK
IEIKTEMESEVKNEGAESAQTTTQTRSRCKMESTFVSRPSTLVSKKGKSGTSIMLSSNHF
RLPTVPNWCVYQYRVDFEPEESRTFIRKGMLKLHKDKVGPYIFDGTILFSSTRLPDLSVH
QFRLELWPGYITSIRQHERDILLNAEITHKVMRQETLYHILMDCYRRSNNYRTEFCNSVI
GIMVLTDYNNHTYRIEDVDFETNPSSTFPMKDGQHISYQEYYKIKYKINISSASQPMLVT
RTKPRMRNAGQGDLVYLVPELCRATGLTDSMRENFHLMKALAVHTCISPTSRIDKLMRFN
NRLRQEPKVLQEFKDWNMSLDKNLLEFPGRLLNSERLLFADNRYINNLNGDWTRDMQKTR
MLKSTALRRWIVLVTERDMHIVHKFIETLLLVSHGIAFRVDQPRIQAIRDDKAGTYAENL
EYILSKNAPDLIFCVVSNNRSDRYAAIKKKCCLDRPVPSQVFLQKNLNGRNTMTIATKVA
IQMNCKLGGAPWTIENPLKGLMVIGFDICHDANTKGKDFLTMVATVDQTLTQYFSSIALF
HSNEDLGDQLCASVRKAIMAYKERNKAFPVHLVIYRDDVSEGQLRQVYENEVQKLEKALE
KLYYGPNFKLIFIIVTKKINVRLFDMRGRNANPRTGTIVDDVITNPLRYDFFIVSQQIRQ
GTISPTSYNVIFDNTGLEVDIVQVVTYKLTHMYYNCSTTVRVPAPCHYAHKLSFLVGRFL
HQPPSSQLEKQLFFL
Download sequence
Identical sequences AC07436-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]