SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC07876-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC07876-PA
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.34e-64
Family BAR domain 0.000000666
Further Details:      
 
Domain Number 2 Region: 268-338
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-22
Family SH3-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC07876-PA
Sequence length 342
Comment ACEP_00007876-RA protein AED:0.0944090213857899 QI:0|0.37|0.22|0.66|1|1|9|0|342
Sequence
MTEKMGGAEGTKLDVDFVDMERKTDVTYELVEELQMKTKEFLQPNPTARAKMAAVKGISK
LSGQAKASTYPQPEGVLGDCMLTYGKKMGEDSIFAQALIEMGEAMKQMADVKYSLDDNIK
QNFLEPLHHLQIKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRQAEEKFEESLHLAQ
MGMFNLLANDVEQVAQLATFSEALLEYHQQCTEVLRGLTEILLEKKEEAVHRPKMEFVPK
TLADLHVDSGLSDHMNGGNFSLHASPLPSPSKSPARTPMTQRTPCCTALYDFEPENPGEL
GFKENDTITLTQKIDENWFEGSLDGRTGYFPVTYVQVVVPLP
Download sequence
Identical sequences AC07876-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]