SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC09351-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC09351-PA
Domain Number 1 Region: 183-491
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.91e-41
Family NodB-like polysaccharide deacetylase 0.018
Further Details:      
 
Domain Number 2 Region: 55-96
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000228
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 110-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC09351-PA
Sequence length 557
Comment ACEP_00009351-RA protein AED:0.0301394793142731 QI:0|0.5|0.2|0.8|1|0.8|5|0|557
Sequence
MMRVGAQLSLFVAQPQKGSIRVKRQEEKKEESFENEICKDKDAGEWFRLVAGEGDNCRDV
IQCTSSGLQAIRCPAGLYFDIDKQTCDWKDSVNNCKLKNKERKAKPMIYTEEPLCQDGLL
ACGDGACIERGLFCNGEKDCTDGSDENICGKSTLKEISNLYRNLINICNLFGVPDMDNDP
NRAPPCDPSVCTLPDCFCSEDGTTIPGDLPSKDVPQMVTITFDDAINNNNIGLYKEIFNG
KRKNPNGCDIKATFFVSHKYTNYSAVQEMHRKGHEIAVHSISHNDDERFWSDATVDEWAK
EMAGMRIIAEKFANLTDNSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAALNNPPLW
PYTMYFRMPHRCHGNLQHCPTRSHAVWEMVMNELDRREDPQNDEYLPGCAMVDSCSNILT
GDQFYNFLNHNFDRHYEQNRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILQSHNDVYFVT
MTQVIQWIQNPRTITESKNFEPWREKCAVEGPPACWVPHTCKLTSKEVPGETINLQTCVR
CPNNYPWVNDPTGDGFF
Download sequence
Identical sequences AC09351-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]