SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC10314-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC10314-PA
Domain Number 1 Region: 653-930
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000108
Further Details:      
 
Domain Number 2 Region: 273-416
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-38
Family Third domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 171-275
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-34
Family Second domain of FERM 0.0000411
Further Details:      
 
Domain Number 4 Region: 526-620
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-22
Family PDZ domain 0.00029
Further Details:      
 
Domain Number 5 Region: 83-169
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.18e-21
Family First domain of FERM 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC10314-PA
Sequence length 943
Comment ACEP_00010314-RA protein AED:0.0858264102821293 QI:179|0.81|0.82|0.94|0.93|0.88|17|0|943
Sequence
MYAWNNLSNPVYRVLRQSQVKRVARIMNGQHSREVVSRRWLTRLHIFEMIESVSRRALSG
SSGSYHVRGAELARNRRLKSLSATVTFLDDTQHTFQLDKRAKGQVLLDLVFQHLELIEKD
YFGLQYAENGVSTTIPTSDIMRWLDPSKPVKKQIRSKGGHFFFRVKFYVSDPSKLQEEYT
RYQFYLQIRRDILQGKLQLPPSTACLIASYTVQSELGDYHPEEHGPGYLSQLQLIPGQTE
EMEKKISELHKLHKGQLPADAEFNFLDHAKRLDMYGVELHKARDSTNKEIQLGVTSIGLV
VFQNGIKINVFSWSKIVKISFKRKQFFIQLRREQSENYDTLLGFNMQTYRSSKNLWKACV
EHHTFFRLHSPKMRPKRFPLTLSSRFTYSGRTEFQTVEDGKHRARVERTFIRSPSKKIAH
TIATVTDDKGKLAIPGRPSRSYDNKVQSLGAREPRQAWGEGNPSDDEGGFLSLREEITGS
YTRGGAFSPALGSRVFSYADDDTTAERNIYDLPDYSEPTSSPAPQILEDGLVTISLTPDE
QGRFGFNVKGGLDLDMPILVSRVAPNTPADRCYPKLNEGDQVVYINGIDVSGLLHERVVN
LIRQSRDRGSGELTLTVRPNALYNALAGTDETSEEEPPYRYVPDAPHAAIGSDALAQSML
LLADGLASGALIAQYEQLYRKNPELTSLESKKPENQSKNRYRDISPYDVTRVILMRSANG
DYINANYVNMEIPGSGIINRYIATQGPLSSTVADFWQMVLEAGSTLVVMLTTLVERGRAK
CHQYWPAYNETLTLRNLTLTSTAENIEDTFIFREFILRDVNTGEERDITHMQYCSWPDHG
VPSDWRQFTMFTERVRAARTGIVEPAVVHCSAGIGRTGVLVLMETALCLIEANQPVYPLD
IVRSMRDQRAMMIQNASQYRFVCEAVHKAYSEGIAKPLPEFSR
Download sequence
Identical sequences AC10314-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]