SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC10732-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC10732-PA
Domain Number 1 Region: 28-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000942
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 542-597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000471
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 688-743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 486-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 432-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000615
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 763-804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 7 Region: 633-688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 8 Region: 866-924
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 314-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Weak hits

Sequence:  AC10732-PA
Domain Number - Region: 373-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00301
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 812-863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00732
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC10732-PA
Sequence length 1001
Comment ACEP_00010732-RA protein AED:0.284895537908867 QI:91|0|0|0.35|0.93|0.88|17|2|1001
Sequence
MPWADGTPCGIDKWCHRGECVSRRNLEPVHGQWGEWGRYGECSRTCGGGVKRKYRECDNP
APNNGGNYCIGERVKYRSCGTRECPSGSPDFREQQCSKFDNNNFNIQNLARDVKWHAKYT
RILPQDRCKLYCQVESNQYYMLRDKVIDGTPCGPDTFHICVNGQCKPAGCDHILNSTADL
DTCGVCRGDNATCQRIAGAYNTSVYGYTRVAKIPAGSSYIDIKQHGWLNSHNDSNYLALR
IGEDGEYILNGNFMVMHRKVIVHPGVTIEYSGPESVVERLNSSRPTAIDLILEAGNVYPP
QITYEYTVPKRILNSYTWLLSDWSTCNRMCQGMKYRKAECRSTEHKEAVPDAYCRNEEKP
QEESQMCNAHCTLQWQTTSMSECSNHCGPGVRTVTSRCVQILLNSSHPPRSIPAHACLHI
EKPSEHQPCVGPCDDAHWSYSEWNVCSVSCGGGVQLRSAICVDSNERQVRDENCVRQEKH
LKRTCNQEACPKWDLGEWSQCSVTCGMGKRHRASWCQVENRVVSRTFCSGTPVVTEVCDA
GPCHQWHASDWSPCSVTCGEGTSRRKVVCKNADGAPSDGCPIAEKPEISVICTLKPCLNV
VSLPPTTYSTNPSREDSSPQENEIDNNGITFHYKWHVGPYGECSQKCNIGFKSRIVRCIS
EIGMVAPDYYCDSNQQPIVRTTCNHHLCPAWNTGDWSECDVTCGNGFQHRQVRCQKHDGE
ILPHKECSEEQPKHVRRCQMESCRSSPKNSRENSLESNIIRKWKMSNWTPCSKSCGTGIQ
TRRVECMMRRGNHGPEVPVKDEQCLITNITHEHCTPDCGKGIQRRAVTCHRVNRYGWIDP
TPTVGCPMDQRPVGEQICKLRECSDKYYWTTGPWRKCSHPCGRKGRQIRRLYCHDAIIDK
KVGRFHCPAEYKPLRKRKCNQRKCGPVTCLEIQKRLKATTDGEYPLLIGGRNMTIYCHGM
SSAEPREYLTLPAGDSENYAEIYDKRLIEEPTHVSVQWSKK
Download sequence
Identical sequences AC10732-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]