SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|12771|fgenesh1_pm.C_scaffold_1000310 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|12771|fgenesh1_pm.C_scaffold_1000310
Domain Number 1 Region: 33-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.08e-100
Family AAT-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|12771|fgenesh1_pm.C_scaffold_1000310
Sequence length 429
Sequence
MAATDRSQLIPFSSRLKEGRALAEDVWSIFNAANLPADCINLGQGYMNFAPPEWVTEQAE
KALHTVAANHYSHPKGRIRLRQAIKDVYSPLFNRELDVEQNILVTSGANEGQYSVFTAFL
EQGDEVIMFEPFFDQYLPSVTFNGGKPVYVPLHPPSHDKANATSGDWTIDLAELRAAVTP
KTKMIILNTPHNPVGKVFTKEELEGIAAVAEENNLLVMSDEVYENLVFDGKQHFRIANLP
GMWDRTVTVCSAGKTFAATGWRVGYLIGPQSILKPTLAATTRIVFCSNSPMQEAVAGGLE
LAPKYDFYATQLREYTARRNILVKAFDDLGLKYSLPEGSYFILLDISDVDFPEDYAFPES
VKGRGRDFRACWFIALEIGVSTIPVSEFYCEEHANIGEAFARFAFCKDEDTLRAAAERLQ
GLKKYIKKP
Download sequence
Identical sequences D8PR17
XP_003036657.1.72525 jgi|Schco1|12771|fgenesh1_pm.C_scaffold_1000310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]