SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|15383|fgenesh1_pm.C_scaffold_4000250 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|15383|fgenesh1_pm.C_scaffold_4000250
Domain Number 1 Region: 24-470
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.93e-96
Family GABA-aminotransferase-like 0.000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|15383|fgenesh1_pm.C_scaffold_4000250
Sequence length 477
Sequence
MSPALTTSIDKASEATKKSLIADRPTHILHRTPWRPPVATKAEGLTITLEDGSTLIDAAG
GAAVVSIGHGHPKVIEAIKDQAEKVCYVYNMQLSNEPAEELADFIIKESDGAFELCGFVS
GGSEAMEGAIKLARQYFWETNQPQRTNFIARQLSYHGNTVSTLGLALHPTRRAPYAGIMD
DKHFHHVSPAYAARFQKADETEEQYVERLRKELEDKFIELGPDTVIGFFAETVVGATTGC
VPPPKGYLKAMKSVCDKYGALFVLDEVMSGMGRMGSYHGWQTYGPDAPPDIQAVAKGLGG
GYASIGAVLMNKRVAEGVRGLWKHGHTYQAQPLSCAASLAVQKVFKEEKLIENCRVQGEY
LGQQLEGKLGRSSPSTAAPFVFNIRGGGMFWGTEFDFTVPEAANLDFKGRAFAISVQQRC
LENGLIVMGLTGGSNLEGTKGDHVMLCPPYTVTKGDIDEIVKRYVQSVEEVLKEAGL
Download sequence
Identical sequences D8Q153
XP_003033351.1.72525 jgi|Schco1|15383|fgenesh1_pm.C_scaffold_4000250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]