SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|15733|fgenesh1_pm.C_scaffold_5000129 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|15733|fgenesh1_pm.C_scaffold_5000129
Domain Number 1 Region: 30-500
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.15e-66
Family AAT-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|15733|fgenesh1_pm.C_scaffold_5000129
Sequence length 504
Sequence
MADAQTVKPASSTATVVDADDELRAQYAHFDRHINRLSRRRVPSPLKDILQFISLDGMIS
LAGGLPHSSLFPFDSVHVSTYDSATRMAMNPSEIAKVDVCVEKQPSSHSTDLRTTLQYGP
FNGIKPIMDWMHAFVERVYAPGYAGWQLLMDGGSTDGWAKVAGMLLDEGDTILVETHTFP
SSQALWVPMGVTAVPIDIDMYGLVPEALARTLDNWEARRPNERKPKTLYCVPVGHNPTGS
TLAADRKQEIYEICVKYDIIIVEDDPYYFLQLPQYQPGGDRALPLEGPTPDAFLAGLVPT
FLHFDREGRVIRLETVSKTLAPGFRLGFIISNPFFHERLGRATEVLTQTASGWSQAVFCE
LVHTWGQDGYVRWLAGISETYTVRRNWMRTQRLFRFVPPSSGMFLWIDVDLRAHPAWDRI
SAPDTLGLPGEEVWATAFWRKLLDARILLAPGTYNKPWQGEGRSAMANVPGHAFFRLTYS
STPQEEMDEGIRRMAQVFRENWSA
Download sequence
Identical sequences D8Q4E7
jgi|Schco1|15733|fgenesh1_pm.C_scaffold_5000129 XP_003031680.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]