SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|15828|fgenesh1_pm.C_scaffold_5000224 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|15828|fgenesh1_pm.C_scaffold_5000224
Domain Number 1 Region: 4-415,453-508
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-123
Family Pyridoxal-dependent decarboxylase 0.0000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|15828|fgenesh1_pm.C_scaffold_5000224
Sequence length 517
Sequence
MVLDIEEFRKAGYAAIDQICDHFYSLQEQPVVAAVEPGYLAKLIPGSPPQEGEPFENIAA
DYKRCILPGITHWSHPSFFAYFPTACTFEGILADLYSSAVSNPGFNWICSPACTELEVIV
MDWAAQLFGLDKAFLNSSTSGGGCLQTTASESALIAAVAARNTYMDSHPQARHEDLVMLC
TTQTHSLALKAGRVLGLAVRTIDVEAKDAYGLRGEGLAQAIADEQAKGHRPFFLIATIGT
TSSGAIDNIAEIREVVSGHPDIWLHVDAAWAGVALSLPEKREELYLADINSAANSLCINF
HKWGLVNFDCSTLWVRDRLTLTQALDVTPLYLRTKEAEAGTVTDFRNWHLALGRRFRSLK
LWFVLRSYGVEGFQAHIRKGIALNEVFVSLIKQSERLVLAAPPSLGLTVFRMVPAAWQKE
ADQVKIEQPAVSKAADEAVVHAAAELTESKTPNALTQALWDRLDRRRGELFLSQTSLNGV
HCVRLAVGAARTEEEHVRRAFAIIEEEAAAVAAELDV
Download sequence
Identical sequences D8Q534
XP_003031803.1.72525 jgi|Schco1|15828|fgenesh1_pm.C_scaffold_5000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]