SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|232621|fgenesh2_pg.2_#_639 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|232621|fgenesh2_pg.2_#_639
Domain Number 1 Region: 35-443
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.9e-64
Family Cystathionine synthase-like 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|232621|fgenesh2_pg.2_#_639
Sequence length 452
Sequence
MAQLTYVPTAIEDDTRLAPLVEDAFFLPTNRDIDAYMRPDQATYVCGASLGPFPKRSKRR
LDEELNVWQKQVVIGHFNHPLGRPWKRYTENVVPLMAEVVGAKEGEVAIMSGLTQNLHTM
LDLFYRPTANRYKILCEANAFPSDQYAMASKVRSHGLDPKAVIHEVHPRPGEYAVTEADI
YDAIEKEGDRIAIVLFAGVHYWTGQLFPIKEITAAAHEKGCIVGWDLAHAAGNVTLSLHD
WGVDFAVWCNYKFLNAGPGSVGALFMHEKWNEEKTPRAAGWWGHKIETRFQFLPDFDPTV
GAQGLQLSNTDVLSTALVWGALETLKDAGMMKPVRERSIQLTGMLQDLVMQSKYYVPLEQ
AHRRTTPGFTIVTPLEAHRRGAQLSLLFLPTGQGVMQKIYEAMKSFGVIADERPPDLYRI
VPNPLYNSSDDMHRVAECLETSFKYMEPRAKL
Download sequence
Identical sequences D8PWZ4
XP_003035205.1.72525 jgi|Schco1|232621|fgenesh2_pg.2_#_639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]