SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|236879|fgenesh2_pg.9_#_49 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|236879|fgenesh2_pg.9_#_49
Domain Number 1 Region: 17-398
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.58e-66
Family AAT-like 0.00000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|236879|fgenesh2_pg.9_#_49
Sequence length 401
Sequence
MKPAHFNIENAVRPNILALHPYRCARDDYQEGILLDANENSLGHSIPSGQSLPQEIQDTL
ALNLHRYPDPSHRAIKERIAALRGLPGPEYVFLGVGSDEVIDLLMRICVAPGKEKILTTP
PTYGMYAVCAQVNDVGVVKVPLELSGANGEGGERGRFSLNVDAIKQAVAADPSIKLIFLC
SPGNPTGTSLSLSSIRELLEYEPYKGVVVVDEAYVDFAGDETSAVSLVREYANVCVMQTL
SKSFGLAAIRLGLALAQPPLMQVLFNTKAPYNISTPAAHLALSALSDDALAAMRAKVATL
TASRAKLLESLKALKDVGLAPAIGGNNANFVMVPVLAKDGSGKPDNARSEKIYKTMAEEH
GVVVRFRGREPGCEGCLRVTVGTEEENGVLVRKLREVMEAI
Download sequence
Identical sequences D8QD91
XP_003028857.1.72525 jgi|Schco1|236879|fgenesh2_pg.9_#_49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]