SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|255875|estExt_fgenesh2_pg.C_20186 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|255875|estExt_fgenesh2_pg.C_20186
Domain Number 1 Region: 61-447
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.89e-59
Family AAT-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|255875|estExt_fgenesh2_pg.C_20186
Sequence length 472
Sequence
MSTPAGERFKNIVRDAMKQWKSEKESEAHRDEETVPGIVHPGSTGVIYCSDRAMANGFSY
AAQHEWANLGQGAPEVGPIPGARDRPTEISVPLDSLEYAPTTGVKDLRTAVANLYNETYR
KGKASQYTHENVCIVPGGRAGLSRVASVVGDVYCSYQVPDYTAYDQVLAAFRRLVPIPTI
LDPNNKYEFDTLHTRKDVEHQGVAVVLLSNPRNPTGQVIKGDKLKELVSLSREGSTLILD
EFYSWYIYPEEGEEFGQSVSSAEYIEDVNEDSVIIIDGLTKNWRLPGWRVCWVVGPKNLI
TALSQSGSFLDGGANHPLQLAAIPMLEPSRVREEKIALQKHFKAKRDHVLARLTDLGLTV
RVPPTSTFYIWLDLTNLPPPLNNGLTFFEELLKEKTIVIPGIFFDINPAHRRNLFKSPCH
EFVRISFGPPIEDLDMGLDAMARVLEKAKKQGMSGFGEGYKQSPEAPVDDHI
Download sequence
Identical sequences D8PV16
XP_003035698.1.72525 jgi|Schco1|255875|estExt_fgenesh2_pg.C_20186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]