SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|256400|estExt_fgenesh2_pg.C_30192 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|256400|estExt_fgenesh2_pg.C_30192
Domain Number 1 Region: 14-434
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.05e-125
Family Cystathionine synthase-like 0.00000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|256400|estExt_fgenesh2_pg.C_30192
Sequence length 439
Sequence
MSEASAAFYKEPEFETIQLHGGQRPDPATNARAVPIYATTSFTFNDSAHGSDLFNLRTGG
FIYSRIGNPTVDVFEQRIAQLEGGVAAVAVASGQAAQFLAITAIASAGDNIVSTSYLYGG
SYNQFKVTFKKYGIETRFVTGTNPEDFIPAINEKTKAIYIESIANPKFNIFDIPAIAKVA
HDHGIPLIIDNTFGIGGYLIRPIEHGADIVVHSATKWIGGHGTTIGGVIVDSGKFDWRKS
GKFPGFTEPSEGYHGLIFSDTFGAAAFAVKVRTELLRDVGPCLSPFAAFLLLQGLETLSL
RGERHSKNALALARWLEQHPHVAWVSYLGLESHSSHELAKKLLRVPGEYGGMLSFGVKGD
AATGSKLVDSLKLASNLANVGDAKTLVIHPASTTHSQLTEEEQLASGVRPDLIRISTGIE
SINDIIADFEGAFKATFGQ
Download sequence
Identical sequences D8PZ60
XP_003034282.1.72525 jgi|Schco1|256400|estExt_fgenesh2_pg.C_30192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]