SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|257266|estExt_fgenesh2_pg.C_50485 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|257266|estExt_fgenesh2_pg.C_50485
Domain Number 1 Region: 2-296,333-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.42e-51
Family Cystathionine synthase-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|257266|estExt_fgenesh2_pg.C_50485
Sequence length 472
Sequence
MDVTKARSQYPILTGPEPFVFADNAGGSQVPKNVVSRVVDYLLNTNVQMGADYPVSQVAT
RRVMVEGPTAAKILFNADSADEIVLGQSSTLNIENLAHGLSTDVKTGDEIIITGEHEANG
GPWKHLAARTGATLKTWPHRQVDPANPYALALVIDDLLPLITSKTRLIAFTATSNILGSV
VPVADVVRAIRAKAAEVGAAKVEVCVDAVAYAPHKRIDVKAWDVDYCVFSAYKVYSAHVS
ALYVRKAALSGSVSSVVHHFLNVPEVAYKLMPGGPGYEAVYALTGIIPYLLSLTLEGEKL
LGETSLLHDPGADSMPLLTNPSMPAVLDGVWSAIAAHELTLMAPLLSFLTHPDQWARGVR
IAGDGGAFLDGGNNAVSAPFQNHVAGRAPTVSFVMVESSNGKPRLRSKEIVEYFDKRGKI
GIRYGHFYAYTLVSQLSPLKDPADGVVRISLVHYNTVEEVERIIEGLKEVLA
Download sequence
Identical sequences jgi|Schco1|257266|estExt_fgenesh2_pg.C_50485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]