SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|258204|estExt_fgenesh2_pg.C_90170 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|258204|estExt_fgenesh2_pg.C_90170
Domain Number 1 Region: 33-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.23e-169
Family GABA-aminotransferase-like 0.000000000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|258204|estExt_fgenesh2_pg.C_90170
Sequence length 506
Sequence
MNRLLCRSLTRTPIYTARRSFVSPLRKMATSTTPEFNKMLYAPLREIDPVVQNIIDKETW
RQFTGLELIASENLTSRATMEANGSILTNKYSEGLPDHRYYGGNEYIDELEQLCRERALK
AFHLDPAKWGVNVQPYSGSTANFAALTALIQPQDRLMGLGLPDGGHLTHGYYTAKKKMTA
SSIYFQSFPYGISTETKLIDYENLSNQAKLFKPRLIICGASAYPRDWDYKALKTVAEREG
AFLMADIAHTSGLVAAQQLNNPFEYCDVVTTTTHKTLRGPRAGLIFFRKDLEHAKDLEKR
VNDAVFPACQGGPHNNTIAGIATALLQAAQPEFQEYAKQVIKNARALAEALVAHGYQLQT
DGTDNHLVLWDLRHLGLTGSKVEKVCDLMGITINKNAVNGDTSAQTPGGIRLGTSALTSR
DMTEEDIKVVAEFLHRAVQIALTLQKEAGSKKLVDFVRVATQKEDGKVGYEQVKALREEV
RAFATKWPLPGVDVKNLKKPEGLHED
Download sequence
Identical sequences D8QDS9
XP_003028943.1.72525 jgi|Schco1|258204|estExt_fgenesh2_pg.C_90170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]