SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|57784|e_gw1.7.151.1 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|57784|e_gw1.7.151.1
Domain Number 1 Region: 21-442
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.56e-48
Family Cystathionine synthase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|57784|e_gw1.7.151.1
Sequence length 454
Sequence
EYCATFAIDELRRTDYRRLTASGETYVDWMGGALYPERLVHAHADFLCSRVLANTHSHSN
PSALSHECANAARAAVLQFFDASPEEYTVIFTPNASGALKLVGEAYPFTDDSAFVLGADS
HNSVNGIRCFAAAKGASVGYIPTTPQGGFEPQQAEAVLNKYRPSPGRSALFALTAQSNIS
NSKAPLALVDAAYTLGYDVLLDAAALAPTSPLSLTAQPAIGALAISFYKMFGYPTGVGAL
VIRRDLLQRLQRPWFAGGTVDLVQVPGNNVTPACELYEQFEDGTINYTSLAAVPAGLRLL
AAYQPLLPLRLTCLLRYMISELQQLRYKDTDSAFVRILSRIPMAAGEAGATASIEFLGEN
GIPISPLLVEQSAARAGIALRTGCACNPGGAAALLGITADMAALPPGATHATFEDAVGRA
LGVVRISLGLVSNFEDVWRVVQWASNVAQNGIDR
Download sequence
Identical sequences D8QAK2
XP_003030326.1.72525 jgi|Schco1|57784|e_gw1.7.151.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]