SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|62391|e_gw1.17.139.1 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|62391|e_gw1.17.139.1
Domain Number 1 Region: 39-87,114-533
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.66e-71
Family AAT-like 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|62391|e_gw1.17.139.1
Sequence length 540
Sequence
MSPSIDIHTSQPAPASTHAPVKAAAPTLSAEEALRAKFMHLEHHINSLSRQRAPSPLKDI
LQFMRLDGMISLAGGLPHPSLFPFDSVHVSTYDSSMRMAENPTDIAKVDVCVEKQPGHST
DLATALQYGPFNGIKPLMDWMTTFIERAFHPGYPEWQIIMDSGSTDGWAKVANLLLEDGD
TMLVEQHTYPSGQALWIPMGVTAVPIDMDLDGLIPEALARTLDTWEAERPQQRKPKVLYC
VPVGQNPTGSTLTAARKQAIYDICVRHDIVIVEDDPYYFLQLPTYRPNSKHALPPPSDPS
AFLAELVPPFLHYDRDGRVIRLETVSKTVAPGFRTGFIICNPLFHERLARATEVTTQAPS
GWSQAILCELLHTWGHDGYIRWLAGIRETYAVRRDWICDSIASHFDVDWDDVTADGVAVY
AQNSNRANLLFRFVPPAAGMFVWLKLDLSSHPTYRRLCAAGAPAAEDAWAAAFWRELVAA
RVLLTPGTYYKPWQGTSVADAPAAPGHAFFRLAFSSTPREELDEGIRRMADVFSASWASA
Download sequence
Identical sequences D8QLH0
jgi|Schco1|62391|e_gw1.17.139.1 XP_003026247.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]