SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|65913|estExt_Genewise1Plus.C_21284 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|65913|estExt_Genewise1Plus.C_21284
Domain Number 1 Region: 10-411
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.69e-122
Family AAT-like 0.00000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|65913|estExt_Genewise1Plus.C_21284
Sequence length 413
Sequence
MSNTVAAESFDDVALAPLDVIFKLSADFKADTFPQKVNLGVGAYRDDNSKPWVLPVIKKA
NELLLNDDSVDHEYLPITGLPEFCDLSGKLLFGADSPVVREKRLSTVQCISGTGSNHLAA
LFLSRFYKFNGEKKAFISQPTWVNHFNIFRNVGIEPVTYPYYDPKTIGLDFDGFLGAVQN
APPKSVILLHACAHNPTGVDPTHEQWQTIARVMKERAHYAFFDCAYQGFASGDLDADAWA
VRHFAAEGIPLLVCQSFAKNAGLYGERVGALHIVAKSADAAARVKSQLAVLQRSEISNPP
AYGARLVAMILGQPELFAQWKQDIKTMAGRIIDMRHELHRLLTQELKTPGNWDHIINQIG
MFSFTGLSPEQCKALIEEYHVYLTSNGRISMAGLNSHNIQYFAKAVDTVVRTK
Download sequence
Identical sequences D8PWW7
XP_003036007.1.72525 jgi|Schco1|65913|estExt_Genewise1Plus.C_21284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]