SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|67670|estExt_Genewise1Plus.C_41322 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|67670|estExt_Genewise1Plus.C_41322
Domain Number 1 Region: 29-434
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-48
Family Cystathionine synthase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|67670|estExt_Genewise1Plus.C_41322
Sequence length 478
Sequence
MDPEIQALIPNAALHELEQQPAPPFGHALAKYFLTRPDYLNLNHGSYGSCPKPVLEWAFD
LDREIEGNPDLFMRVDCAPLLAKVRQQLADFIGVKQNEVVIVPNASHGLNTVLWNIEWEA
DDTILVCTTTYNSIEKTVTYLHDRAPHPSISQFVLYHPTTREKILSDWETHVKDLAASKT
SGKIVAVIDSISSNPGILLPWEKMVTIAKKYGALTVIDAAHSIGQEPNLKGKIAESDPDF
FVSNAHKWLFAKRGAALFYVPERNQGIVKATFPVSATYKSPKDRKTPNESFVVQYDWNGT
TDWANYLSIPAALKFRNWLGGEDAIIAYNHKLAFEGTKRMAEIMGTDMMYPEDTGFELSM
VNVALPLPPFGKGQEELSHKAQDLFQRKVLEERKVGAPKFEHNGRLWTRLSGQVWLEMED
FEKTAHHIKEACKEIIEELGLDKYVPLAKAATHEQLKSDPVGRRGKEQVVYHIIQRHR
Download sequence
Identical sequences D8Q281
XP_003033543.1.72525 jgi|Schco1|67670|estExt_Genewise1Plus.C_41322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]