SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|69580|estExt_Genewise1Plus.C_80520 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|69580|estExt_Genewise1Plus.C_80520
Domain Number 1 Region: 14-402
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.32e-86
Family AAT-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|69580|estExt_Genewise1Plus.C_80520
Sequence length 412
Sequence
MALNFRVGKGILSTLSPPIPQAHAWATAYKPTPNRPLLNMSQGVPGIPPPPKVQKALATA
AANPESFRYTLPEGDPPMRAALAAEMKHVYGPQCDVTADDIALTAGCNLAFVASIMALTD
AGDEVILPVPWYFNHQMTLSMLGLETVCLKTYPEDGFQPSVERCEKLITPKTKAIALVTP
NNPTGAVYSRSLLAKFAKLAADKGVALILDETYRDFITSGEPPHSLFDSPDWRRTVVHCY
SFSKAYCIPGHRLGAIVASPEFLTHVTTVLDTVQICPQRVVQLALAPLLPSLRGFVADTA
RAVEHRHKLFREALPPAWRLGAQGGYYAFVRHPFKHVAAFDVCKRLAVELGVVTLPSAFF
CEEKVNGEVKEVTVEDEDKWIRFSVANIADENVQKVCERLKESETALGWELE
Download sequence
Identical sequences D8QC30
jgi|Schco1|69580|estExt_Genewise1Plus.C_80520 XP_003029764.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]