SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|72393|estExt_Genewise1.C_11604 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|72393|estExt_Genewise1.C_11604
Domain Number 1 Region: 60-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-111
Family GABA-aminotransferase-like 0.000000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|72393|estExt_Genewise1.C_11604
Sequence length 472
Sequence
MKRAVTSLSTLQRSSRTGAARFSTSVRAQSGPSTRYTAATHTPSAPSPSVRDTLATGEKY
LLPVYARPQFVLSHGKGSKVWDTDGRCYVDFSAGIAVNALGHGDEEFVKVITEQTSKLLH
TSNVFHNEWAPRLAELLVELTRREGGLGLSDPSVGAKAFFANSGTEANEGALKIARKVGK
ERWAAKTGRSWEDGGCAKTRIVCFEQGFHGRSMGALSVTTNPKYQKPFTPLIPGVDVGKL
NDVAGLEGLIGEDTCAVIVEPIQGEGGINAASEEWLRALRKRCDEVGAVLIYDEIQCGLY
RTGSIWAHSKLPLDCHPDAVTMAKPLANGYPIGAVLMRDSVAEVMTAGTHGTTFGGSPLA
CALGFHVLSRLSSENIAKQVQETSAHLVSRLQKLPGYFPTVLQPEIRGRGLILGLGFKDP
AHPGKVVEMARERGVFVLTAGKDAVRLVPSLNIPREDVDFAVDVLESVLGQL
Download sequence
Identical sequences D8PKJ1
XP_003036855.1.72525 jgi|Schco1|72393|estExt_Genewise1.C_11604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]