SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|74545|estExt_Genewise1.C_21219 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|74545|estExt_Genewise1.C_21219
Domain Number 1 Region: 7-399
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.55e-83
Family GABA-aminotransferase-like 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|74545|estExt_Genewise1.C_21219
Sequence length 400
Sequence
MSAEARAINFGAGPSALPQSVLEETAKGLLNFEGTGIGIAEISHRSKEFTAYVRNLESLI
REQLEVPPTHHIIFTQGGGTGQFSAVVLNMLARHRLLHPELTDEERVLDYVITGSWSKKA
CEEAKRLGGGRVNVVADGRKHSQDGKSFKSIPPPDTYTFSENPALIYYCENETVDGVQFA
HTPGTTAFPYDRLPKNALVPLVADYSSSFMSRPIPRLADHAIIYAGAQKNIGPAGLTILI
VRQDCVVDVDAAAKLGAVPTPITMSYKTLVESGSLYNTPSVLPLYMTGLVVQRMKQLGGL
SYFEQTNKSKAEKVYAVLKEGEAKGKLRGKVQEGSGSWMNVVFDVLGEGEEAKFLAGAEA
RNLKGLKGHRSVGGIRASLYNAVTEEDTDKLVDYIKEFIA
Download sequence
Identical sequences D8PWS3
jgi|Schco1|74545|estExt_Genewise1.C_21219 XP_003035990.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]