SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|76738|estExt_Genewise1.C_50761 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|76738|estExt_Genewise1.C_50761
Domain Number 1 Region: 328-473,515-809
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.18e-60
Family GABA-aminotransferase-like 0.0000959
Further Details:      
 
Domain Number 2 Region: 10-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.37e-29
Family Nitrogenase iron protein-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|76738|estExt_Genewise1.C_50761
Sequence length 812
Sequence
MSSLFKHLRVHQIFGANTDVGKTLLTTALVRASAARGHDVFYLKPVSTGSMNEADDGHIQ
RFTSSVKSKVHADCLYRYTEPVSPHLAVKLDQKDAQNVSGAPADGTVVNAIAEHIKTCAS
RAHKLAGNPLAHMYVETAGGVHSPSLSGTTQLDLYRPLFLPTILVGDSKLGGISSTISSF
ESLHLRGYTVDAILLFREGYYRNWEYLKSYFSERDIPVFALDKPPDLHPDPTQNFARTDK
YYQSVTSADGADSIASILDHLDSRHAQRQTELYSMPRRALDTIWWPFVQHGLIAGEKDIN
VIDSAHRDFFSVHRPTSDPSASALQPQFDGSASWWTQALGHAHPAVALAAAHAAGRYGHV
MFPSAVHAPVLELAERLVQGPGAGWADYAFFSDNGSTGMEVALKMALRAYAVRHELRGTE
EAKKLGILGLKGSYHGDTLGAMDACEDGGVYSCEWHNARGVWLEPPTVGIREGAVYVRVP
GAVVGKDADELVRADSLSRVYDVEYRMQTTLAKSYEAHIRKVLGNIERDDTQLGALVLEP
LVMGAGGMIFVDPLFQRVLIDVVRGRGSSRSPSSSTVSSTSTANSSWTGMPVIFDEVFAG
LHRLGLESAAPLLGVTPDIAVYAKILTGGLLPLAATLASRDIYNAFLSDSKADALLHGHS
YSAHAVGCAVANEALNQIARLEKEGTWDSARARWAPTTTEEARVWSLWDPTFVKALSKHD
KIAEVMTLGTVLAVKVKTEQGGYVSHSAQELLKGLGNVERGEGGLSSAPGGAPFSIHFRT
LGDVAYLMLSLNTEDKVVREVEDRVWQAIAAA
Download sequence
Identical sequences D8Q596
XP_003032272.1.72525 jgi|Schco1|76738|estExt_Genewise1.C_50761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]