SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|79423|estExt_Genewise1.C_120145 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|79423|estExt_Genewise1.C_120145
Domain Number 1 Region: 48-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.51e-92
Family Cystathionine synthase-like 0.000000047
Further Details:      
 
Domain Number 2 Region: 441-653
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-37
Family GHMP Kinase, N-terminal domain 0.0000221
Further Details:      
 
Domain Number 3 Region: 670-826
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.6e-35
Family Mevalonate kinase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|79423|estExt_Genewise1.C_120145
Sequence length 892
Sequence
MAPTIDLRRVRDLPTPEPESPLGPRKPYKFSTMCATVENPEAKDQYGSSSVPIYQTATFK
GVGGQYDYTRSGNPTRSHLEHHLAKISSAQHAFAVSSGMAALDVILRLLKPGDEVIAGDD
LYGGTNRLLTFIKTHVGVTVHHVDTTNAENVRPHIHPTKTALVLLESPTNPLIKIVDLAT
VTRDVKEKAPGAIVVVDNTMMSPYLQRPLEHGADIVYDSATKYLSGHHDLMAGVITCNRE
DIAKKMAFTINSVGNALSPIDSFLLLRGVKTLAIRMDRMQATAGVVANYLHGLGFKVNYP
GLPNHPNREVHERLSDGNGAVLSFETGSKELSERIVGGTRLWGISVSFGCVNSLISMPCV
MSHASIDAKTRKERGLPEDLIRLCVGIEDASDLLDDLEHALYDAGAISLNAAQNKFVRTP
LPDSPEAEAEAEKLADEDEETEWFVSSPGKVILFGEHAVVHGVTAIAASVDLRCYGLCSP
RHDGKVSVHLHDIDNFAGAWDIKSLPWDVVTPVGLGEQPPETLNFKLIEALYNGPLKSLA
ADRYRHAKAASVAFLYIYMTLAGRRRPSFNFSARATLPVGAGLGSSASFSACAATALLLL
HRRISIPPPPAPSSAETGHVNRWAFVAEKILHGNPSGVDNSVAVFGGALAYTRGLNGRPA
GMVPIQGFRRLKFLLTNSRVPRDTKKLVAGVGELKQREPEMVGRVLKSIQHIVDEAQRAL
TDAELPREALLHALAAWINENHSYLVSLGVSHPTLENIRAKTASAPYGLSTKLTGAGGGG
CAVTLVPDDFSDENLAALCQDLVDAAFEPYSTSVGGSGLGILSPYAHHRNFEAEARQNSG
VVTPPVTPGPELGSPKAVEETQPLPPLRQSFERTSLAELGEWAEGLGRWLYV
Download sequence
Identical sequences D8QIC3
XP_003027110.1.72525 jgi|Schco1|79423|estExt_Genewise1.C_120145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]