SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|82131|estExt_fgenesh1_pm.C_40432 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|82131|estExt_fgenesh1_pm.C_40432
Domain Number 1 Region: 40-464
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.85e-123
Family GABA-aminotransferase-like 0.000000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|82131|estExt_fgenesh1_pm.C_40432
Sequence length 469
Sequence
MLRATTKSVLSGVARQSTRSASTYGALHDFGTKHVNKGVGRLVPGIMEKGEGSYVTYEDG
RRMLDFTCGIGVTNLGHCHPKVSQAAAEQCMKIVHAQNSISFHRPYLELIERLLPTMPDP
SLDSFFFWNSGSEAIEGALKMARLMTGRKGFICMQGAYHGRTYGAMAVTKSKTIYSEGTG
PLMPMVYTTPYPYFHQLGLPPSSSPEEHTRAALHQLHLLFKQAIRPDSVAAIIIEPLLGE
GGYVPAPTSYLKALRELCDKHGILLIVDEVQSGFARTGKWWCIEHSGVRPDIMTFAKGLA
NGFPLSGIVSRKELTDKLKPGCMGGTYAGNAVSCAASIAVCDAFKEEKVLENVEARSKQL
FATLNSLKSDPEVGKYLLDVRGQGLMAAIEFARPPKDIEIDLATNGVEGCPSNFAARVGK
KCIEKGMLILTTSIYEVLRIIPPLNVSEADMAKGCQIIAEAVKEVAKEG
Download sequence
Identical sequences D8Q280
jgi|Schco1|82131|estExt_fgenesh1_pm.C_40432 XP_003033542.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]