SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|258981|estExt_fgenesh2_pg.C_180037 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|258981|estExt_fgenesh2_pg.C_180037
Domain Number 1 Region: 18-127
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.001
Further Details:      
 
Domain Number 2 Region: 164-263
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|258981|estExt_fgenesh2_pg.C_180037
Sequence length 480
Sequence
MPAQSTLNADEKGKVKAAIPAPSNKIFFAALARIYYAHPVPSEWAYAGLQGALAIVRDAS
KANALFFRLVDLTGTRGVIWEHELYQGFEYNADRAYFHSFAGDKCMIGFVFADESEAKTF
VKKVTKQNNQKASKSSSSSSQKKKKPAKGGKIDKSMISGPASGSFIHVAHMGYDAEKGFT
TKGVDPSWTAFLGQLEGSGVDRETIAREMDFIKDFVRNHPQQQAPAAAAPQPKEKKAKSK
PPPPPRRGHGHTNSAGNAPPPPPARGSRASQPPPPPPSRGPAHPPPPPARGLSLRRRLHL
PLHRGPRAQRRLRLPRVRPLLPPAPPPPPPPSGGAPPPPPPPPPPPMGGAPPPPPPPPPP
PAGGAPPPPPPPPPPAGGGGPPAGLPPPSDARGALLASIQGKGVHALKKTEGPPPRPSPG
AVVGAAGAGAAVGAAAGAGAAAASGGGGGDLTSALAAALMQRNKDMGDSSDEDEDDEDWD
Download sequence
Identical sequences D8QLV6
XP_003026077.1.72525 jgi|Schco1|258981|estExt_fgenesh2_pg.C_180037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]