SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|69511|estExt_Genewise1Plus.C_80423 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|69511|estExt_Genewise1Plus.C_80423
Domain Number 1 Region: 610-798
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00073
Further Details:      
 
Domain Number 2 Region: 111-146
Classification Level Classification E-value
Superfamily WW domain 0.00000359
Family WW domain 0.004
Further Details:      
 
Weak hits

Sequence:  jgi|Schco1|69511|estExt_Genewise1Plus.C_80423
Domain Number - Region: 78-107
Classification Level Classification E-value
Superfamily WW domain 0.0685
Family WW domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|69511|estExt_Genewise1Plus.C_80423
Sequence length 834
Sequence
MATPAPTDSAPAPAHEIATPETPDQPDVQPTTPHRGLPALDTKDAPVPRVGTPLTLSPNS
RAKKAAENRDGEWGANFWVTLIDPQTDTPFFACPATGEVSWDAPVGNFVLPPSSEGEWWE
LTDDTRGGIPYYYQTKTGETVWERPNAFVIPLGIIQVRAHRMSMMAYNGPPITSAKDAGK
AGYRRTKSYNKDLDTHFDRSVRKSQSTRTVLGNKSSSLSPASAHIQRRAFSNETRLLAHH
GHHHHSRMGGTHLPPIPASPASSEKSRPPSSASRKSMSSLPHGESSLRKKGSPGRPHTGN
DGNISDSPSPSRKHVSYMKPMTPQSLNAAVEKLQGSHSDTATLDMSPVKKRTLQQPIPVQ
SSVVAPSVAPSTNASLRASAIPVLPHDLAMDIQQFSQSDYAKKYFSTHRRGFLFRRTIPV
TQLMAWQKQPLTSPLQTLDRSLHKQAVRTFKVVQYIMGDREKDRHIGGRTEGFSQQKNAS
STSLGSTQTSSMLEEERWLLGEGVSHPELRDEIYCQVIKQLTGNPNPESAFRGWQLICVL
LITFPPSKNFESYLRSFIQQHTSKQEGRIDVMAKYCLRRLAVISKKGPRGKAPTVTEIET
ASDAAFNPSTFGESLDAIYRLQERNYPQAKVPIILPFLADGILALGGTKHEGIFRVPGDG
DIVSELKLRIDRGFYTLDGIDDPHVLASLMKLWLRELCDPLVPEEMYNECITSAKDPEAC
VRIVERLPTINRRVVLFVISFLQLFLDERTQAITKMTSANLALVMAPNLLRCNSESMTVV
FTNAQFEQIFVHNLLLHLKCNDIDPDYAPQHGLGAVPATSQSRSSKSRTRRNPH
Download sequence
Identical sequences D8QBW1
XP_003029328.1.72525 jgi|Schco1|69511|estExt_Genewise1Plus.C_80423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]