SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_00165--XP_001120851.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_00165--XP_001120851.1_APIME
Domain Number 1 Region: 168-413
Classification Level Classification E-value
Superfamily vWA-like 1.18e-76
Family Integrin A (or I) domain 0.000000774
Further Details:      
 
Domain Number 2 Region: 424-503
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-16
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 688-781
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000968
Family Integrin beta tail domain 0.006
Further Details:      
 
Domain Number 4 Region: 596-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Weak hits

Sequence:  Cflo_00165--XP_001120851.1_APIME
Domain Number - Region: 62-108
Classification Level Classification E-value
Superfamily Plexin repeat 0.000314
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 647-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000893
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 562-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_00165--XP_001120851.1_APIME
Sequence length 854
Comment [mRNA] [translate_table: standard]
Sequence
MPQYPFVNRERWYRDSRLVVRTTLSPYVDVNGEIMTRWATTIFLFLMTRFFVLAFSQHRD
RESLCESQQTCASCLQTPRCVWCSMMVSGQNASSPLLRCVSKQTFLKENHLWCPLSDVIH
HENTMDILENRPLSSIKGKDPVQVQPQKIRLRLRRGEDYRVILKYSQAEDYPVDLYYLMD
LSASMEPYRDKLSKLGLQLAKAMQKLTSNFRIGFGSFIDKVVLPMTNTQPDKLESPCTLK
TGEPCAPPYDYKNQMSLTENVALFEDQVQAAPVSGNLDGPEGGLDAMMQVIVCTKEIGWR
QKARHLIVFSTDAVFHVAGDGKLAGIIEPNDCMCHLDEKGFYTYSLLQDYPSISQLNRKA
REHNMNIIFAVPDHKNMTYQRLSQHISGSSTGTLENESQNVVALVSSEYEKLVDSVTIID
TAPKIIDIKYFSRCLNKTGELLERQECEGLRVGNVIEFEVVIKVVECPDEPKNWQQTVEI
KPRGLNESLTIDLEIICDCPCEKPGHSGYRMNAAECKNNGKSMCGVCSCNPGFYGKQCEC
EGNEVGAGNSISIADCKPDNQTVEICSGHGTCKCGVCDCDKRPNNPHEMFYGKYCECDNF
SCKRSGGQVCGGRGKCECGTCNCLPGWGGETCDCKETNSTCIAPSNGNVEICSGRGDCIC
GSCHCQERDNIRYSGQYCEECPTCPGQRCEELKDCVECVAYNTGPLAKDGKCDLCMHEID
IVDVVEEDPVKDEETGARICRTPGDAGCTFVFKYQYHRDGTGGDIKIFKIQAQKERTCPA
PINVFGVALGVVISTVIVGFLILLIWKILTMIHDKREYARFERERALAKWDRGENPLYKQ
ATSTFSNPTFNVKD
Download sequence
Identical sequences E2A0M9
XP_011268919.2.72520 Cflo_00165--XP_001120851.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]