SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_01224--XP_395067.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_01224--XP_395067.3_APIME
Domain Number 1 Region: 2146-2288
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-33
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00045
Further Details:      
 
Domain Number 2 Region: 1996-2117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00083
Further Details:      
 
Domain Number 3 Region: 1709-1755
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000233
Family Tachycitin 0.014
Further Details:      
 
Domain Number 4 Region: 990-1050
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000128
Family BSTI 0.053
Further Details:      
 
Domain Number 5 Region: 624-684
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000196
Family ATI-like 0.029
Further Details:      
 
Domain Number 6 Region: 3206-3266
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000262
Family ATI-like 0.047
Further Details:      
 
Domain Number 7 Region: 1100-1162
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000409
Family ATI-like 0.024
Further Details:      
 
Domain Number 8 Region: 2868-2930
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000152
Family BSTI 0.041
Further Details:      
 
Domain Number 9 Region: 182-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 682-722
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family Fibronectin type I module 0.072
Further Details:      
 
Weak hits

Sequence:  Cflo_01224--XP_395067.3_APIME
Domain Number - Region: 1154-1200
Classification Level Classification E-value
Superfamily FnI-like domain 0.000534
Family Fibronectin type I module 0.066
Further Details:      
 
Domain Number - Region: 85-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 3590-3670
Classification Level Classification E-value
Superfamily FnI-like domain 0.000994
Family Fibronectin type I module 0.067
Further Details:      
 
Domain Number - Region: 3247-3331
Classification Level Classification E-value
Superfamily FnI-like domain 0.00628
Family VWC domain 0.021
Further Details:      
 
Domain Number - Region: 2408-2444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00726
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number - Region: 3443-3525
Classification Level Classification E-value
Superfamily FnI-like domain 0.0146
Family Fibronectin type I module 0.054
Further Details:      
 
Domain Number - Region: 1524-1576
Classification Level Classification E-value
Superfamily FnI-like domain 0.0303
Family VWC domain 0.062
Further Details:      
 
Domain Number - Region: 3518-3597
Classification Level Classification E-value
Superfamily FnI-like domain 0.0439
Family VWC domain 0.051
Further Details:      
 
Domain Number - Region: 3661-3746
Classification Level Classification E-value
Superfamily FnI-like domain 0.0868
Family VWC domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_01224--XP_395067.3_APIME
Sequence length 3873
Comment [mRNA] [translate_table: standard]
Sequence
MLNDAPDIAIEDSYSVKNRKGGRRIFAGGCARRPDTPINGKLKCSLNSGCTASCAPDYQF
PNGALHLIITCVDKEWHIEGTEWNSIPHCEPICMPECQNKGICIAPHHCNCPEHFSGPQC
QFENKPCLNYPPPVLNSYKKCNSKTCTVSCMEHFTFPDSSSVANLICKDGNWKPTRSDWV
SIPDCEPVCEPPCQNGGNCLPTNLCQCPQDYRGPQCQYSANTCDTEKLRFNGGYYCTGDS
ESYSCTLNCPTGVEFEFSPATAYICTYDKGVFEPQPIPQCKIDNNIKIISLGTSYNTYVR
ESNHSWSMHDIFGTKHSQGIHDGYYGIHGSDASLYPIQSNGVMIFEMNKPKPKTCFTWSG
AHYKTFDDRIYSFDSDCAHTLLQETRDGICTIVVLNSPGCKSGSSSRCVKIIKLFVHDKE
YTLTSNEMGMSVFSNSKRSLPIPVYLPGLRVDKSAHFTIVSLDSLGMKLKWDGALLLQIE
ASESMWNKTTGLCGTMNDDQNDEFLTKSGSYASSIPTLANSWRVDDLGEICDDYPSTRHA
CESKNELTRDAFEFCNELLSNHKFKTCANTINFSELTESCLWDYCACEHDDKRKCACDTM
DVYIRQCAHKGIAQLTAWRNNDTCPIFCDGGRVYLSCGPKAEASCFSGIEAKQEISSECE
EGCFCPAGTLEHEGKCISPEECPCRLRGKLFQPGTSVQKKCNTCTCISGKWVCTQIRCGA
RCAIVGDPHYTTFDGKHYDFMGKCKYYLMKGENYTIESENVPCSGAISENLGFTFVGSPS
CTKSVTINFKDTIIKLKQNRQITINGDEITKFPILFNGARIRIASSIFVVIRLPNALKVW
WDGVSRVYINAPAEFHDRTKGLCGTFTENQKDDFITPDGDTETAAIVFANKWKTNEYCID
ELESEPKHPCDLNPQRRARAEEYCSKIHSNIFSDCHWYVDPQEFYRDCMYDMCACDTDVT
SCLCPMLAAYAKDCATLGVKLLWRAEIDECKIHCTGGQTYQICGNSCTRSCSDVSFYRDC
KQECVEGCNCPEDQTLNANGECIPIVQCPCFFAGREYKPNHREVRPGNKGQECCSCIGGV
WECRLATPDEIREYPPVTDLFCPASKHLEVTDCQPVEQRTCSNMHIPIEQTPSVCTSGCI
CKSGYVLDVTNGICVKKEDCPCLHGGKSYKEGSVMQDGCNTCTCKNTKWKCTDRTCAGIC
SVWGDSHYKTFDGKMYSFQGICDYVLAKSTLSKEECFDISIQNVPCGTNGVACSKSIKLL
IGSGEQQEELILTKGKELPKETYKRMTIRDAGLFVFVDVPDLGLVLQWDKGTRVYVRLNP
EWKSRTMGLCGDYNDNAEDDFKTPSGGISEVSVNLFGDSWKKNAFCLEPKDMQDDVCERH
PERKLWSLRQCNVLKSPLFSSCHSEVEVEPYLRDCIFDTCSCDAGGDCECLCTALAAYAH
ECNVRGVPVKWRTQELCPIQCDEKCSTYSACVSTCPRETCDNLMIVKHSSHLCTEDTCVE
GCQFKPCPDDHVYQNSSYTECIPKSMCAKPFCIEMNGTTYYEGDRVSGDDCHSCFCSRGK
VTCNGEACTSTTMANNATIPSTELQKCVDGWSLWINKDPEVKGKKFLDVETLPNLMDFPD
VNGFPICDKEHMVDIRCRSVKEHLSPKESGLDVECSLERGLYCQSHLPDLPCVDFEISVL
CRCFEPTTHGVENTTTEIGKECDVAHPNSPHPTNCQLFYHCIITPTGHELVEKSCGPGTL
YNSKTQVCDWPAQVIRIRPECFEPERTTQTSSGTEWSTNYENTTTKTVSTINVCKDGEMW
NECAIQCVRTCQYYRHILMTQGHCNEDTDCVAGCVLIDQPMCHFPKFWRDGITCVEANHC
PCKSHDGNSVAPGAIKKESDCETCQCINNYYTCDTTFCYNVSSHEETVGTGKVPEQTETV
TTQSSFSTISGSTWKTSPITSSPSIEHTIFIQSTVTPPEECDDANYVPLIRNLGKKVTIR
ASSSKNPVLQFEDLLIYTEGNFPSSSEKFWEPEITNTDQWLDVEFDRPEPVYGVILQGAV
TKDEFVTSYKVLFSEDGQSFSYTLDHEKQPRVFRGPADRIQSVQQRFYQPIEARIIRINP
LTWHNGIAVKMEVLGCQDHIISVMMTSTTEQSIIKTTMSEKIVRPVCEDSMGLNNGLMTI
EQISVSSSPQLIQNLSLSSEGVWRAALDNPHQYIQFDFLETRNLTGIITKGGDNAWTTVY
KVFYSNDGHHWNPVIDKNGNEKEFLGNFDAESQQTNFFEKPLHARLLRVQPIKWHDHVAL
KIEILGCYLAYPSMKTSEITSTTTSSSFERECNICDGMDRTILNDETRCKCEDPYWWDGE
SCVSKWECPCIIGHVSYAVGSIYETEDCQQCTCVLGGTPTCSPKKCETCLEPGLQSIVSK
LCTCLCKPCPAGTRHCPTSDVCVNETSWCDGIQDCPDDEKDCPEIISTTPIAVEISEITN
TTGLQIITTSSPIQIPLPCEKPFCSLGYRVVFKQSRLHHHKTNIKSNNRKGFTKTKGHKK
YMFHEHPMKNQENQPIVEDIQCPEFICIPKPPVLSDDKKPQTCPEAACPPQYEVVFERTS
MYKKHKCPKYICRPLKPQEAVCNVIGRTFNTFDNMEYKYDICNHILARDMYGNEWYITLE
KLCLDSHGQQRCTRILVVTLNERTIVLYPNLQVDIDGYTFTAKQIARFGNRFPGFELLRT
GDRIIFLSHHYGFWVIWDSSTNVKIGVVAKLVGRVDGLCGYFDGNVANDRQTPEGTQARS
IIQFGNSWAMEGAKECDLHVCPHDVQEQAWTICSSVKSPMLLGACSAIVDLDRFVSRCVE
SVCSCLHSSNTSYEDCRCRLLTSFVSECEAAADYDTNLLTDWRTVYDCPANCPSPFVHRD
CFRSKCEITCDNLHEVEPCPPMRDICFPGCFCPDGLVRRNDNECVPPARCLDCVCDGLGD
AKFIDFNRKNFRFTDNCTYLLSGNTMENAKNQRNETRAYQLLITNGYCATGICTEVITLL
YDEHVVQIKRAELSKDLQVSIDDSRVERFPTDHTWIVLNQMSTGDVTLLVPFIQLEFVAF
RQNFAFTLKLPSHIFSDVTEGLCGNCNADTEDGFEKRGGEITQDVEEFGKSWLIKDLPMQ
LGLSDRTCSSNRQSPCTPPPAEEDICKKLLDLPQFMQCHSIVDPKPYMDCCYDALCTGGS
YCDSLEMYARKCLEAGLCPAWRTDEICPYECSKDLIYQPCGSSCKETCDTLNKSDNPKCA
SGPVEGCFCPENYVFHNDSCVLKQDCFICDQEGHVQGDIWYPDKCTECNCNNGVVNCQKT
ECPVLDTICDENMTPILVNGTEERCCAKYLCAPKPTAPTICIEPQEPECGFGQIMKAIID
ADGCHKFICQCLPVNECPTFDELSNEVEQLQSGFVQVMNTSGCCPRPAKICDPKTCPSAA
KCPDYFNTTVIVLANSCCPTYECVPPKDVCLYTNENQSSQPVIVKQIGEEWKDGKCKTCL
CENSHDGPKANCLIMECPSMDAQSDMELYVLEEIQLDDKCCPIFERTACRWEDKIYNVGE
NWKPNIKNACLSMYCDKKLDSVQILTKVQECNTVCDYGYTYQAPNDTSVNCCGTCIQVAC
IADGILKEVGEHWYSDDHCVTYFCESTNGSVYIHANTETCPEIDPQLESEYEVEERKIPE
KCCPEYVKTACRSDGQIYKSGEKWRSLTDNCVIETCVGPNITKRKEIEVCSTQCSPLSLA
VSPAACPDITDCPAESIYHDHCCKRCNLTILNIEKEINKTCNTVFVDANNTVGMLVVNHL
LHGKCKNLDVVEGIKQCSGTCQSSTFFDSGSWSQVSNCYCCQAEKYSGLIQVNLTCEDGE
ILKKQLAIPSSCACQSCASSDVKSENRKTKSKS
Download sequence
Identical sequences E2AVY8
Cflo_01224--XP_395067.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]