SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_01525--XP_001122348.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_01525--XP_001122348.1_APIME
Domain Number 1 Region: 26-90
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000314
Family Tachycitin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_01525--XP_001122348.1_APIME
Sequence length 124
Comment [mRNA] [translate_table: standard]
Sequence
KKEQDLSKIPGIPGVDYPIYHVVPPTSFSCAYVPIIPGMYANVETGCQAYHICHDGREGH
QGASFLCTNGTLFNQHEFACDWWYNVNCANAPSFYRLNADPLKNPYVPKETKDEIRKRLK
IVVF
Download sequence
Identical sequences Cflo_01525--XP_001122348.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]