SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_02090--XP_001122292.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_02090--XP_001122292.1_APIME
Domain Number 1 Region: 110-161
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000628
Family Tachycitin 0.027
Further Details:      
 
Domain Number 2 Region: 39-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000785
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 291-352
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000915
Family Tachycitin 0.027
Further Details:      
 
Domain Number 4 Region: 168-216
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000162
Family Tachycitin 0.018
Further Details:      
 
Domain Number 5 Region: 222-283
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000017
Family Tachycitin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_02090--XP_001122292.1_APIME
Sequence length 361
Comment [mRNA] [translate_table: standard]
Sequence
MKEIYLIAIVFLASQAAAYVIAGNESSTFEAENECPAADPCPPKLIYYEKDCNHYYECKN
QEKNLKECKTGLYFSNKWQGCVKPENSECKNSGDDPGDNPGDNPGDNPGDETTCVNNGDL
LPHECQCTKFYECKNKKKALRDCPLGQFFDKDRQTCIPGKNCKAVGTECKDGDLINHECQ
CNKYYLCKNGLKALQECKAGYYFDTDLSQCVKGTCATDSKTCTKGEKKKHECYCEKYYAC
KNKEWIAQECKKGQHFSPTEQKCIKGDVDDECNSLTPTPIPTPTPTPTPTPPGEPGDCPE
GVPTLWRHECDCRLYYECINEKKQLQICAWGKYFDYVNQVCEEAKKVSPKCQNTWDDWLS
K
Download sequence
Identical sequences E2ACM5
Cflo_02090--XP_001122292.1_APIME XP_011255562.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]