SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_04482--XP_395734.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_04482--XP_395734.3_APIME
Domain Number 1 Region: 1331-1581,1653-1694
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.2e-99
Family Type II chitinase 0.00000118
Further Details:      
 
Domain Number 2 Region: 1744-1996,2068-2108
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.65e-97
Family Type II chitinase 0.00000167
Further Details:      
 
Domain Number 3 Region: 524-768,834-883
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.1e-83
Family Type II chitinase 0.00000354
Further Details:      
 
Domain Number 4 Region: 2259-2522,2599-2640
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.48e-78
Family Type II chitinase 0.00000973
Further Details:      
 
Domain Number 5 Region: 131-356,426-476
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.88e-38
Family Type II chitinase 0.00076
Further Details:      
 
Domain Number 6 Region: 1996-2067
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.16e-17
Family Chitinase insertion domain 0.0006
Further Details:      
 
Domain Number 7 Region: 1581-1652
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.68e-16
Family Chitinase insertion domain 0.00085
Further Details:      
 
Domain Number 8 Region: 2522-2598
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.43e-16
Family Chitinase insertion domain 0.00073
Further Details:      
 
Domain Number 9 Region: 1018-1074
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000107
Family Tachycitin 0.0042
Further Details:      
 
Domain Number 10 Region: 768-833
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000000657
Family Chitinase insertion domain 0.00075
Further Details:      
 
Domain Number 11 Region: 1145-1203
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000837
Family Tachycitin 0.015
Further Details:      
 
Domain Number 12 Region: 2193-2248
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000023
Family Tachycitin 0.013
Further Details:      
 
Domain Number 13 Region: 356-425
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000428
Family Chitinase insertion domain 0.00027
Further Details:      
 
Domain Number 14 Region: 1217-1272
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000128
Family Tachycitin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_04482--XP_395734.3_APIME
Sequence length 2660
Comment [mRNA] [translate_table: standard]
Sequence
MVAWIILLTLVSLSSAVPSKRQVSIEEILPFTPSRNEQRGSVRSFRRDAIERPPTPTFDR
LSNYFDYGNEFGSHRYPLRDAVESLPANVLYAESSHKFRDDFESVDVDYESIWIEPVAPP
ILRGTQNFEPKIVCRFNSKAVHRTEPFSLLPENVPDHKCTHLIYDAAILEKDNIFLRDPY
DQDGYNAIIKLRSRDPTLRVLISITNLNLHDGLFIQYFSHTTLFRQKSILEFLEEYPFDG
IELDWPAAAEDWQSFKSMLKIIGALLSRKGYTLAVALRPEDPVDPELLSIVDLLILRSWQ
DMSFCQDSSCKMKNEIMEKIALHPGPLSFVAQNMSEWIRQVSIEQRSKIVLALPIFGQGY
TLKYDNLTDTGAPILGPGREGDYTKQQDGKLAYYEICDKLEKGLWFSGRDEEGPYIKRGD
QWIGYDDPISVKVKIAYVRATGLGGVALWSLDLDDFQGICGNPWPMLNTAVEALGYYKDT
LAVNCLHEYYLFGVDQEDCSRFYSCIKGISSKQKNMLLRQKGPRVVCYVTSWALYRKEDG
KFVPEHLDSQLCTDIVYAFAGLNPETLLMQSFDPWADIENNLYQRVTSIRGSRILLALGG
WTDSSGDKYSRLVSNDAARRKFVAATVNYLKEHNFDGLSFEWSYPKCWQSDCKKGPDSDK
PNLTKLIQELREEFDKQEPPLLLAIALSGYKEVIDRAYEVREISRAVDFMSVMAYDYHGA
WESKSGHIAPLFGSPSDSNPYYNVNFTMSYLVRLGAEKSKLLVGIPLYGQSYRLSTASQA
GLGDPTTGPGKPGEFTKQPGMLAYYEICDRIKQYGWKTKPGPSAQFEDQWVGFEDRESVY
AKGKYIAANGYGGATMWTVDLDDFQNRCCSESYPLLKSINRALDRLSTPISEDCQRPPQP
VTPQAPTLTTHSDAANNGNSHHTTPMTTSSTQTTTWPTWTERPSTATQQTTKTTWPMWTW
TTQKPSSKIPEETTKPSWIQEPSTTSSTTSWTTSRAPTTRPTTTTTTTQESIITTPGTTC
TDGEYYSDPASCSNYYRCVRGELKREQCAPGLHWDAKRHLCDWPSAAKCQTETGSTHIYT
STTNRRPLLSSTRRPPSFTTTVKITSTMTTTTTTPTTTTTPTTTTPTTTTKFTTSKPIIF
VTSTQKPLKPCQHGQYYPYPNSCTSFLVCVNGELVSRQCGPGLNWNVEKNMCDWAFKNPC
VETSPHKNALLVGKDNTCISGSYSSVPGDCGSYQACLWGHQEVFSCAPGLHFNKETRICD
WPARAKCANDDKEATTQITIPTTNLPVQPSSTSQKPVTQPTATEQTLVTSTTSQPTSTLP
SAIIDPDKVSPLSGDFKVVCYFTNWSWYRRGIGRYLPEHIDHTLCTHIVYGFAVLDYSEL
VIKAHDSWADYDNRFYERVVAYKKRGLKVLLALGGWNDSAGDKYSRLIHSLSARNKFIDH
AIQFIEKYGFDGLDLDWEYPVCWQVDCNKGPDSDKERFATLLQELSAKFKPKGLLLSAAV
SPSKKVIDKGYDVPALARYLDWIAVMAYDYHGQWDKKTGHVAPMYYHPDDDYSYFNVNYS
INYWISKGAPPKSIVMGMPLYGQSFTINDPRAGTGLNSPASAGNAGEFTRAAGFLSYYEI
CDRVRNRGWTVVQDQEYRMGPYAYKGSQWVGFDDPEMIRRKAQFIRDMGLGGGMVWALDL
DDFRGRCGNGPHPLMHVIQQVLAKPRSDMYIWSENQKPTTTTMSVTIKPTQTIQPTMSVD
HTTLNTPRNELKVICYFCNWAWYRQEGGRFMPEDIDPDLCTHVLYGFAVLDGSSLTIKSH
DPWADIDNKFYERVAAFKSKGLKVLMALGGWNDSAGDKYSRLVNSPTARQKFVAQALHFI
EKYGFEGLDLDWEYPVCWQVDCNKGPESDKEGFSQLVKELSDEFKPRGLLLSAAVSPSKR
VIDAGYDVPVLSKYLDWISVMTYDFHGQWDKKTGHVAPLYHLPSDWEPTFNANFSIHYWI
EKGANPQKLVMGAPLYGQSFSLAEINVHGLNAPTYGGGEAGEATRARGFLSYYEICERTL
KRGWTVIQDKERRIGPYAYKGDQWVSFDDAQQIKLKAEFIKKLGLAGGMVWALDLDDFKN
RCGCEPSPLLRTMNRVLRNYPEGPLCPVTEGTETIIIDIDQTDMESTTVSERPIYESTTS
PRPTYTPSITTTTVTTTIESDTDDTIEIEASSPPPIDCGGLLFLPHQSDCTKYYLCNFGK
ISEQSCPTGLFWNKNRCDWPENTKCTQTAQRQISMSPRLTTVENASDKKVVCYYTSWSSK
RMSFGKFLPEDIDGELCTHIVYAFATLNIKESENRRNTPTFTLNVDDSTDIYRHFLNKAA
EVRKKNGVKILLGLGGWNDSKDNKYSRLADSSTIGQFAQYTAQFVQKHGFDGLHLNWQFP
VCWQADCNNGLQRDSFNFYRLLHKFNETFKSKELLLSIEVSASKIVIDNAYIAIPSLVQY
VDWIGIMTYDYHNSWERETGHVAPLYYYPSDDTVFLNVNFSVRYWLDKGVPANKIIMGIP
AYGSSFTLAVPQNYTVASPGFHAEVSGPGEPGKFTKSSGFLAYYEICDNVRNDGWSVTKD
PEGRVGPYASKRYQWVSYDDISDIARKADLIKELNLGGGMIWSIDLDDFKNLCGCGKYPL
LTTLNRKLGRRQPGHATDCT
Download sequence
Identical sequences E2AX77
Cflo_04482--XP_395734.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]